Gene Information

Name : yeeW (ECUMN_3412)
Accession : YP_002414077.1
Strain : Escherichia coli UMN026
Genome accession: NC_011751
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3525479 - 3525967 bp
Length : 489 bp
Strand : +
Note : Evidence 4 : Homologs of previously reported genes of unknown function

DNA sequence :
ATGAAACTGGCCCTGACGCTGGAAGCTGACAGCGTTAACGTACAGGCACTGAACATGGGGCGAATTGTCGTTGACGTCGA
TGGTGTTGAGCTTGCCGAACTGATTAACGTGGTCTGCGATAATGGCTACTCCCTTCGTGTTGTTGATGAATCTGACCGGA
CCTCAACAGACAGCATACCCCCCTCTGCTGCCCTGAGCGGTATACGCTGTAGTACCGCGCATATCACGGAAACAGACAAC
GCCTGGCTGTACTCGCTGTCGCATCAGACGAATGACACCGGCGAATCAGAATGGATTCATTTTACAGGTAGCGGATATCT
GTTACGTACCGATGCGTGGTCATACCCGGTTCTGCGGCTTAAACGCCTGGGGCTGTCAAAAACGTTCCGCCGTCTGGTTG
TCACACTTACCCGACGTTATGGCGTCAGTCTCATTCATCTGGATGCCAGCGCTGAATGCCTGCCGGATTTACCCACTTTC
GACTGGTAA

Protein sequence :
MKLALTLEADSVNVQALNMGRIVVDVDGVELAELINVVCDNGYSLRVVDESDRTSTDSIPPSAALSGIRCSTAHITETDN
AWLYSLSHQTNDTGESEWIHFTGSGYLLRTDAWSYPVLRLKRLGLSKTFRRLVVTLTRRYGVSLIHLDASAECLPDLPTF
DW

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42102.1 hypothetical protein Not tested PAI II 536 Protein 6e-62 93
unnamed CAI43904.1 hypothetical protein Not tested LEE Protein 8e-59 92
unnamed AAL57574.1 unknown Not tested LEE Protein 5e-52 91
unnamed AAL08479.1 unknown Not tested SRL Protein 3e-59 91
unnamed AAC31487.1 L0008 Not tested LEE Protein 3e-60 91
Z5092 NP_290243.1 hypothetical protein Not tested LEE Protein 4e-60 91
unnamed ACU09434.1 conserved hypothetical protein Not tested LEE Protein 3e-60 91
ECs4540 NP_312567.1 hypothetical protein Not tested LEE Protein 4e-60 91
Z1223 NP_286758.1 hypothetical protein Not tested TAI Protein 3e-60 91
Z1662 NP_287164.1 hypothetical protein Not tested TAI Protein 3e-60 91
c5148 NP_756996.1 hypothetical protein Not tested PAI II CFT073 Protein 2e-57 90
yeeW ADD91698.1 YeeW Not tested PAI-I AL862 Protein 1e-57 89
z5092 CAD33790.1 Z5092 protein Not tested PAI I 536 Protein 6e-58 89
unnamed CAD66208.1 hypothetical protein Not tested PAI III 536 Protein 5e-59 89
yeeW CAE85205.1 YeeW protein Not tested PAI V 536 Protein 9e-57 88
APECO1_3485 YP_854326.1 hypothetical protein Not tested PAI I APEC-O1 Protein 5e-56 87
yeeW AAZ04462.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 3e-56 87
yeeW NP_838488.1 hypothetical protein Not tested SHI-1 Protein 2e-56 86
yeeW NP_708774.1 hypothetical protein Not tested SHI-1 Protein 2e-56 86
aec77 AAW51760.1 Aec77 Not tested AGI-3 Protein 4e-56 85
yeeW CAI43849.1 YeeW protein Not tested LEE Protein 1e-56 85
ECO103_3593 YP_003223450.1 hypothetical protein Not tested LEE Protein 2e-55 85
unnamed AAK00483.1 unknown Not tested SHI-1 Protein 1e-49 85

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yeeW YP_002414077.1 hypothetical protein VFG1621 Protein 3e-62 93
yeeW YP_002414077.1 hypothetical protein VFG0787 Protein 1e-60 91
yeeW YP_002414077.1 hypothetical protein VFG1070 Protein 1e-59 91
yeeW YP_002414077.1 hypothetical protein VFG1531 Protein 2e-58 89
yeeW YP_002414077.1 hypothetical protein VFG1683 Protein 2e-59 89
yeeW YP_002414077.1 hypothetical protein VFG0664 Protein 5e-57 86