Gene Information

Name : ECUMN_3389 (ECUMN_3389)
Accession : YP_002414060.1
Strain : Escherichia coli UMN026
Genome accession: NC_011751
Putative virulence/resistance : Unknown
Product : putative transposase ORF2, IS66 family
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 3503713 - 3504063 bp
Length : 351 bp
Strand : +
Note : Evidence 4 : Homologs of previously reported genes of unknown function

DNA sequence :
ATGATCTCGCTCCCATCAGACACTCGAATCTCGCTGGTTGCCGGCGTTACTGATATGCGTAAATCCTTCAACGGTCTGGG
TGAACAGGTACAACATGTGCTGGATGAGAACCCCTTCTCCGGTCACCTGCTCATCTTCCGTGGCCGACGGAGTGACATGA
TTAAAATCCTCTGGGCTGATGCTGATGGTCTGTGCCTGTTCACCAAACGCCTGGAGGAAGGCCTGTTTATCTGGCCTGCG
GTGCGTGACGGTAAGGTATCCATTACCCGCTCGCAGCTGGCAATGCTCCTCGATAAGCTGGACTGGCGTCAGCCAAAAAC
ATCCCGTCTTAACGCACTGACAATGTTGTAA

Protein sequence :
MISLPSDTRISLVAGVTDMRKSFNGLGEQVQHVLDENPFSGHLLIFRGRRSDMIKILWADADGLCLFTKRLEEGLFIWPA
VRDGKVSITRSQLAMLLDKLDWRQPKTSRLNALTML

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 9e-47 95
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 9e-47 95
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-46 93
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 2e-45 92
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 2e-45 92
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 7e-36 66
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 7e-36 66
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 2e-35 65
unnamed AAL08461.1 unknown Not tested SRL Protein 4e-32 63
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 7e-32 62
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 7e-32 62
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 7e-32 62
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 7e-32 62
unnamed AAC31493.1 L0014 Not tested LEE Protein 5e-32 62
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 5e-32 62
unnamed AAL99258.1 unknown Not tested LEE Protein 5e-32 62
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-31 62
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 5e-32 62
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-31 62
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 4e-31 61
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 4e-31 61
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 2e-23 60
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 1e-32 59
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 1e-32 59
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 4e-26 56

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECUMN_3389 YP_002414060.1 putative transposase ORF2, IS66 family VFG1737 Protein 5e-47 93
ECUMN_3389 YP_002414060.1 putative transposase ORF2, IS66 family VFG1665 Protein 8e-36 65
ECUMN_3389 YP_002414060.1 putative transposase ORF2, IS66 family VFG1052 Protein 1e-32 63
ECUMN_3389 YP_002414060.1 putative transposase ORF2, IS66 family VFG1709 Protein 2e-32 62
ECUMN_3389 YP_002414060.1 putative transposase ORF2, IS66 family VFG0792 Protein 2e-32 62
ECUMN_3389 YP_002414060.1 putative transposase ORF2, IS66 family VFG1698 Protein 3e-32 62
ECUMN_3389 YP_002414060.1 putative transposase ORF2, IS66 family VFG1517 Protein 8e-24 60