
|
Name : rpmE2 (ECUMN_0329) Accession : YP_002411094.1 Strain : Escherichia coli UMN026 Genome accession: NC_011751 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L31 type B Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG0254 EC number : - Position : 356178 - 356441 bp Length : 264 bp Strand : - Note : RpmE2; there appears to be two types of ribosomal proteins L31 in bacterial genomes; some contain a CxxC motif while others do not; Bacillus subtilis has both types; the proteins in this cluster do not have the CXXC motif; RpmE is found in exponentially g DNA sequence : ATGAAACCCAATATCCATCCTGAGTATCGTACTGTGGTGTTCCATGACACCAGTGTTGATGAGTACTTTAAAATCGGCTC GACTATCAAAACAGACCGTGAGATTGAGCTGGATGGCGTAACGTATCCGTACGTGACAATTGATGTCTCTTCTAAATCGC ACCCGTTCTATACAGGGAAGCTGAGAACAGTGGCATCAGAAGGAAATGTTGCACGATTCACCCAACGTTTTGGTCGTTTT GTTAGCACGAAAAAGGGGGCATGA Protein sequence : MKPNIHPEYRTVVFHDTSVDEYFKIGSTIKTDREIELDGVTYPYVTIDVSSKSHPFYTGKLRTVASEGNVARFTQRFGRF VSTKKGA |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| rpmE2 | NP_286687.1 | 50S ribosomal protein L31 | Not tested | TAI | Protein | 2e-34 | 94 |
| rpmE2 | NP_287095.1 | 50S ribosomal protein L31 | Not tested | TAI | Protein | 2e-34 | 94 |