Gene Information

Name : ECUMN_0318 (ECUMN_0318)
Accession : YP_002411085.1
Strain : Escherichia coli UMN026
Genome accession: NC_011751
Putative virulence/resistance : Unknown
Product : transposase ORF A, IS3 family
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 344825 - 345172 bp
Length : 348 bp
Strand : +
Note : Evidence 2b : Function of strongly homologous gene; Product type pe : putative enzyme

DNA sequence :
GTGATATCCTCACCACAACACAAAACAGGTGACTTAATGAACAAGAAAACCAAACGTACTTTCACCCCTGAATTCAGGCT
GGAATGTGCACAGCTAATTGTTGATAAGGGCTACTCATATCGACAAGCCAGTGAAGCGATGAATGTCGGTTCTACCACGC
TTGAGAGTTGGGTGCGCCAGCTCAGGCGAGAGCGTCAGGGGATTGCGCCCTCTGCCACACCTATTACTCCAGACCAGCAA
CGTATCCGCGAACTGGAAAAGCAGGTTCGCCGCCTGGAGGAACAAAATACGATATTAAAAAAGGCTACCGCGCTCTTGAT
GTCCGACTCGCTGAACGGTTCACGATAG

Protein sequence :
MISSPQHKTGDLMNKKTKRTFTPEFRLECAQLIVDKGYSYRQASEAMNVGSTTLESWVRQLRRERQGIAPSATPITPDQQ
RIRELEKQVRRLEEQNTILKKATALLMSDSLNGSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 2e-48 99
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 2e-42 99
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 2e-48 99
unnamed AAC31483.1 L0004 Not tested LEE Protein 1e-48 99
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 9e-49 99
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 6e-49 99
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 5e-32 64
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 7e-32 64
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 5e-32 64
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 7e-32 64
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 5e-32 64
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 5e-32 64
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 5e-32 64
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 5e-32 64
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 3e-24 61
l7045 CAD33744.1 - Not tested PAI I 536 Protein 2e-24 60
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 2e-24 60
api80 CAF28554.1 putative transposase Not tested YAPI Protein 1e-19 55
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 9e-23 53
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 2e-20 51
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 6e-22 50
tnpA CAB61575.1 transposase A Not tested HPI Protein 6e-20 50

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECUMN_0318 YP_002411085.1 transposase ORF A, IS3 family VFG0784 Protein 6e-49 99
ECUMN_0318 YP_002411085.1 transposase ORF A, IS3 family VFG1123 Protein 2e-32 64
ECUMN_0318 YP_002411085.1 transposase ORF A, IS3 family VFG1485 Protein 6e-25 60
ECUMN_0318 YP_002411085.1 transposase ORF A, IS3 family VFG1553 Protein 4e-23 53