
|
Name : ECIAI39_2026 (ECIAI39_2026) Accession : YP_002407993.1 Strain : Escherichia coli IAI39 Genome accession: NC_011750 Putative virulence/resistance : Virulence Product : putative phage regulatory protein Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 2072715 - 2072903 bp Length : 189 bp Strand : - Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type h : extrachromosomal origin DNA sequence : GTGTTAAGCACTGATCGGTTTATACGTGAAAAAGAATGCGAAAAACTAACCGGCCTTAGCCGTACGTGTCGCTACCGCCT GGAAAAGGCCGGACAATTCCCATCACGTCGTAAACTTGGCGGTCGTTCCGTTGGCTGGTCTTTATCCGAGGTTCTGGCCT GGAAGGATAGCTGCAAGGCAGTTCATTAA Protein sequence : MLSTDRFIREKECEKLTGLSRTCRYRLEKAGQFPSRRKLGGRSVGWSLSEVLAWKDSCKAVH |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| VC1785 | NP_231420.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 3e-06 | 44 |
| VC0395_A1382 | YP_001217325.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 3e-06 | 44 |
| VPI2_0033 | AAX20900.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-06 | 44 |
| SF2987 | NP_708761.1 | hypothetical protein | Not tested | SHI-1 | Protein | 0.11 | 42 |
| rox | AAR97599.1 | regulator of excision | Not tested | SHI-1 | Protein | 0.078 | 42 |
| unnamed | CAE85187.1 | hypothetical protein | Not tested | PAI V 536 | Protein | 0.068 | 42 |
| S3190 | NP_838473.1 | hypothetical protein | Not tested | SHI-1 | Protein | 0.11 | 42 |
| VC0497 | NP_230151.1 | transcriptional regulator | Not tested | VSP-2 | Protein | 2e-06 | 42 |
| ORF SG104 | AAN62325.1 | phage-related protein | Not tested | PAGI-3(SG) | Protein | 4e-05 | 41 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| ECIAI39_2026 | YP_002407993.1 | putative phage regulatory protein | VFG1118 | Protein | 9e-07 | 44 |
| ECIAI39_2026 | YP_002407993.1 | putative phage regulatory protein | VFG0651 | Protein | 0.032 | 42 |