Gene Information

Name : ECIAI39_2026 (ECIAI39_2026)
Accession : YP_002407993.1
Strain : Escherichia coli IAI39
Genome accession: NC_011750
Putative virulence/resistance : Virulence
Product : putative phage regulatory protein
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 2072715 - 2072903 bp
Length : 189 bp
Strand : -
Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type h : extrachromosomal origin

DNA sequence : 
GTGTTAAGCACTGATCGGTTTATACGTGAAAAAGAATGCGAAAAACTAACCGGCCTTAGCCGTACGTGTCGCTACCGCCT
GGAAAAGGCCGGACAATTCCCATCACGTCGTAAACTTGGCGGTCGTTCCGTTGGCTGGTCTTTATCCGAGGTTCTGGCCT
GGAAGGATAGCTGCAAGGCAGTTCATTAA

Protein sequence : 
MLSTDRFIREKECEKLTGLSRTCRYRLEKAGQFPSRRKLGGRSVGWSLSEVLAWKDSCKAVH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
VC1785 NP_231420.1 transcriptional regulator Not tested VPI-2 Protein 3e-06 44
VC0395_A1382 YP_001217325.1 transcriptional regulator Not tested VPI-2 Protein 3e-06 44
VPI2_0033 AAX20900.1 transcriptional regulator Not tested VPI-2 Protein 2e-06 44
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 0.078 42
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 0.068 42
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 0.11 42
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 0.11 42
VC0497 NP_230151.1 transcriptional regulator Not tested VSP-2 Protein 2e-06 42
ORF SG104 AAN62325.1 phage-related protein Not tested PAGI-3(SG) Protein 4e-05 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECIAI39_2026 YP_002407993.1 putative phage regulatory protein VFG1118 Protein 9e-07 44
ECIAI39_2026 YP_002407993.1 putative phage regulatory protein VFG0651 Protein 0.032 42