Gene Information

Name : ECIAI39_1033 (ECIAI39_1033)
Accession : YP_002407053.1
Strain : Escherichia coli IAI39
Genome accession: NC_011750
Putative virulence/resistance : Unknown
Product : transposase ORF A, IS3 family
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 1097385 - 1097732 bp
Length : 348 bp
Strand : -
Note : Evidence 2b : Function of strongly homologous gene; Product type pe : putative enzyme

DNA sequence :
GTGATATTCTCACCTCAACACAAAACAGGTGACTTAATGAACAAGAAAACCAAACGTACTTTCACCCCTGAGTTCAGGCT
GGAATGTGCACAGCTGATTGTTGATAAGGGCTATTCGTATCGACAAGCCAGTGAGGCGATGAATGTCGGTTCTACCACGC
TTGAGAGCTGGGTACGTCAGCTCAGGCGAGAGCGCCAAGGTATTGCGCCCTCTGCAACACCCATTACCCCTGAACAGCAA
CGTATTCGCGAGCTGGAAAAGCAGGTTCGCCGACTGGAGGAACAAAATACGATATTAAAAAAGGCTACCGCGCTCTTGAT
GTCCGACTCACTGAACGGTTTACGATAG

Protein sequence :
MIFSPQHKTGDLMNKKTKRTFTPEFRLECAQLIVDKGYSYRQASEAMNVGSTTLESWVRQLRRERQGIAPSATPITPEQQ
RIRELEKQVRRLEEQNTILKKATALLMSDSLNGLR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 3e-49 98
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 5e-49 98
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 2e-41 97
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 8e-47 96
unnamed AAC31483.1 L0004 Not tested LEE Protein 6e-47 96
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 8e-47 96
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-31 63
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 4e-31 63
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-31 63
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-31 63
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-31 63
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 6e-31 63
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-31 63
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 6e-31 63
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 1e-23 61
l7045 CAD33744.1 - Not tested PAI I 536 Protein 9e-24 60
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 9e-24 60
api80 CAF28554.1 putative transposase Not tested YAPI Protein 2e-19 56
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 6e-22 53
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 2e-21 52
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 4e-20 52
tnpA CAB61575.1 transposase A Not tested HPI Protein 1e-19 51

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECIAI39_1033 YP_002407053.1 transposase ORF A, IS3 family VFG0784 Protein 2e-47 96
ECIAI39_1033 YP_002407053.1 transposase ORF A, IS3 family VFG1123 Protein 2e-31 63
ECIAI39_1033 YP_002407053.1 transposase ORF A, IS3 family VFG1485 Protein 3e-24 60
ECIAI39_1033 YP_002407053.1 transposase ORF A, IS3 family VFG1553 Protein 2e-22 53