Gene Information

Name : EC55989_4941 (EC55989_4941)
Accession : YP_002405792.1
Strain : Escherichia coli 55989
Genome accession: NC_011748
Putative virulence/resistance : Unknown
Product : transposase ORF2, IS66 family
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 5032523 - 5032873 bp
Length : 351 bp
Strand : -
Note : Evidence 4 : Homologs of previously reported genes of unknown function

DNA sequence :
ATGATCTCACTCCCATCAGGTACCCGTATCTGGCTCGTTGCCGGCGTTACCGATATGCGTAAATCCTTCAACGGACTGGG
AGAACAGGTACAACATGTGCTGAATGATAATCCCTTCTCCGGTCACCTGTTTATCTTCCGTGGCCGACGGGGTGACACCG
TCAAAATTCTTTGGGCTGATGCTGATGGTCTGTGCCTGTTCACCAAACGCCTGGAGGAAGGCCAGTTTATCTGGCCTGCG
GTACGTGACGGCAAGGTATCCATTACCCGCTCGCAACTGGCAATGCTCCTCGATAAGCTGGACTGGCGTCAGCCAAAAAC
ATCCAGCCGTAACTCACTGACAATGTTGTAA

Protein sequence :
MISLPSGTRIWLVAGVTDMRKSFNGLGEQVQHVLNDNPFSGHLFIFRGRRGDTVKILWADADGLCLFTKRLEEGQFIWPA
VRDGKVSITRSQLAMLLDKLDWRQPKTSSRNSLTML

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 1e-47 97
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 1e-47 97
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 2e-48 95
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 2e-48 95
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 3e-48 94
unnamed AAL08461.1 unknown Not tested SRL Protein 4e-35 69
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 7e-35 68
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-34 68
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-34 68
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 1e-34 68
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 1e-34 68
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 1e-34 68
unnamed AAC31493.1 L0014 Not tested LEE Protein 7e-35 68
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 7e-35 68
unnamed AAL99258.1 unknown Not tested LEE Protein 7e-35 68
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-34 68
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 6e-40 67
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 6e-40 67
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 5e-27 67
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 5e-34 66
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 5e-34 66
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 2e-39 66
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 4e-36 60
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 4e-36 60
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 3e-28 55

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EC55989_4941 YP_002405792.1 transposase ORF2, IS66 family VFG1737 Protein 7e-49 94
EC55989_4941 YP_002405792.1 transposase ORF2, IS66 family VFG1052 Protein 2e-35 69
EC55989_4941 YP_002405792.1 transposase ORF2, IS66 family VFG0792 Protein 3e-35 68
EC55989_4941 YP_002405792.1 transposase ORF2, IS66 family VFG1698 Protein 4e-35 68
EC55989_4941 YP_002405792.1 transposase ORF2, IS66 family VFG1709 Protein 3e-35 68
EC55989_4941 YP_002405792.1 transposase ORF2, IS66 family VFG1517 Protein 2e-27 67
EC55989_4941 YP_002405792.1 transposase ORF2, IS66 family VFG1665 Protein 6e-40 66