
|
Name : EC55989_4847 (EC55989_4847) Accession : YP_002405704.1 Strain : Escherichia coli 55989 Genome accession: NC_011748 Putative virulence/resistance : Virulence Product : phage regulatory protein Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 4965708 - 4965944 bp Length : 237 bp Strand : - Note : Evidence 4 : Homologs of previously reported genes of unknown function DNA sequence : ATGTTGACCTCAATGACAGGCCACGACTGCGTGTTGCTGCGTGCCGACGATCCCCTGATCGACATGAACTACATCACCAG TTTCACCGGTATGACAGATAAATGGTTTTACAAGCTGATCAGTGAAGGCCATTTCCCGAAACCCATCAAGCTGGGCCGCA GCAGCCGCTGGTACAAAAGTGAAGTGGAGCAGTGGATGCAGCAGCGAATTGAGGAATCACGAGGAGCAGCAGCATGA Protein sequence : MLTSMTGHDCVLLRADDPLIDMNYITSFTGMTDKWFYKLISEGHFPKPIKLGRSSRWYKSEVEQWMQQRIEESRGAAA |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| unnamed | CAD33739.1 | hypothetical protein | Not tested | PAI I 536 | Protein | 4e-30 | 95 |
| c5192 | NP_757040.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 5e-30 | 95 |
| Z1188 | NP_286723.1 | hypothetical protein | Not tested | TAI | Protein | 2e-23 | 90 |
| Z1627 | NP_287131.1 | hypothetical protein | Not tested | TAI | Protein | 2e-23 | 90 |
| S3190 | NP_838473.1 | hypothetical protein | Not tested | SHI-1 | Protein | 2e-17 | 70 |
| SF2987 | NP_708761.1 | hypothetical protein | Not tested | SHI-1 | Protein | 2e-17 | 70 |
| ECO103_3577 | YP_003223438.1 | transcriptional regulator | Not tested | LEE | Protein | 1e-17 | 70 |
| rox | AAR97599.1 | regulator of excision | Not tested | SHI-1 | Protein | 2e-17 | 70 |
| unnamed | CAE85187.1 | hypothetical protein | Not tested | PAI V 536 | Protein | 7e-18 | 70 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| EC55989_4847 | YP_002405704.1 | phage regulatory protein | VFG1480 | Protein | 2e-30 | 95 |
| EC55989_4847 | YP_002405704.1 | phage regulatory protein | VFG0651 | Protein | 6e-18 | 70 |