Gene Information

Name : yeeU (EC55989_2262)
Accession : YP_002403296.1
Strain : Escherichia coli 55989
Genome accession: NC_011748
Putative virulence/resistance : Virulence
Product : antitoxin of the YeeV-YeeU toxin-antitoxin system; CP4-44 prophage
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2308139 - 2308507 bp
Length : 369 bp
Strand : +
Note : Evidence 1b : Function experimentally demonstrated in the studied species; PubMedId : 14594833; Product type h : extrachromosomal origin

DNA sequence :
GTGTCAGACACACTCCCCGGGACAACACTTCCCGACGACAATCACGACCGCCCCTGGTGGGGGCTGCCCTGCACCGTGAC
GCCCTGTTTCGGGGCACGTCTGGTGCAGGAGGGTAACCGGTTGCATTACCTTGCCGACCGCGCCGGTATCAGAGGCCTGT
TCAGCGATGCAGATGCGTACCACCTGGACCAGGCCTTTCCGCTGCTGATGAAACAACTGGAACTCATGCTCACCAGCGGT
GAACTGAATCCCCGCCATCAGCATACCGTCACGCTGTATGCAAAAGGGCTGACCTGCAAAGCCGATACCCTCAGCAGTTG
TGGTTACGTTTATCTGGCTGTTTATCCGACGCCCGAAATGAAAAATTAA

Protein sequence :
MSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
yeeU YP_853121.1 antitoxin of the YeeV-YeeU toxin-antitoxin system Virulence PAI IV APEC-O1 Protein 6e-54 100
unnamed CAD66206.1 hypothetical protein Not tested PAI III 536 Protein 3e-51 95
yeeU NP_838486.1 structural protein Not tested SHI-1 Protein 5e-50 95
yeeU NP_708772.1 structural protein Not tested SHI-1 Protein 5e-50 95
yeeU YP_854324.1 hypothetical protein Not tested PAI I APEC-O1 Protein 4e-50 95
yeeU AAZ04460.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 3e-50 95
unnamed AAK00481.1 unknown Not tested SHI-1 Protein 7e-50 94
yeeU CAD42100.1 hypothetical protein Not tested PAI II 536 Protein 5e-50 93
c5150 NP_756998.1 hypothetical protein Not tested PAI II CFT073 Protein 1e-49 93
yeeU CAE85203.1 YeeU protein Not tested PAI V 536 Protein 1e-49 93
aec75 AAW51758.1 Aec75 Not tested AGI-3 Protein 6e-50 92
unnamed CAI43903.1 hypothetical protein Not tested LEE Protein 1e-49 92
yeeU ADD91700.1 YeeU Not tested PAI-I AL862 Protein 1e-48 91
Z1220 NP_286755.1 structural protein Not tested TAI Protein 3e-47 91
Z1658 NP_287161.1 structural protein Not tested TAI Protein 3e-47 91
unnamed AAL57576.1 unknown Not tested LEE Protein 2e-49 91
unnamed AAL08477.1 unknown Not tested SRL Protein 5e-47 89
ECO103_3591 YP_003223448.1 hypothetical protein Not tested LEE Protein 6e-47 89
unnamed AAL67343.1 intergenic-region protein Not tested PAI II CFT073 Protein 3e-47 89

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yeeU YP_002403296.1 antitoxin of the YeeV-YeeU toxin-antitoxin system; CP4-44 prophage VFG1681 Protein 1e-51 95
yeeU YP_002403296.1 antitoxin of the YeeV-YeeU toxin-antitoxin system; CP4-44 prophage VFG0662 Protein 1e-50 95
yeeU YP_002403296.1 antitoxin of the YeeV-YeeU toxin-antitoxin system; CP4-44 prophage VFG1619 Protein 2e-50 93
yeeU YP_002403296.1 antitoxin of the YeeV-YeeU toxin-antitoxin system; CP4-44 prophage VFG1068 Protein 2e-47 89