Name : EC55989_2249 (EC55989_2249) Accession : YP_002403285.1 Strain : Escherichia coli 55989 Genome accession: NC_011748 Putative virulence/resistance : Unknown Product : transposase ORF 2, IS66 family Function : - COG functional category : L : Replication, recombination and repair COG ID : COG3436 EC number : - Position : 2295457 - 2295804 bp Length : 348 bp Strand : - Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe : enzyme DNA sequence : ATGATAAATCTTCCCGCAGGCACAAAAATCTGGCTGGTTGCCGGTATCACCGATATGCGCAACGGCTTCAATGGCCTCGC CGCAAAGGTGCAGACCGCGCTGAAAGATGACCCGATGTCCGGCCACGTCTTCATCTTCCGGGGACGCAGCGGCAGTCAGG TAAAACTGCTCTGGTCCACCGGCGATGGTCTGTGCCTGCTGACAAAGCGACTAGAACGTGGTCGCTTCGCCTGGCCCTCA GCCCGCGATGGCAAAGTGTTCCTGACGCCGGCGCAACTGGCGATGCTGATGGAAGGTATCGACTGGCGACAGCCAAAGCG GTTACTGACATCCCTGACCATGTTGTAG Protein sequence : MINLPAGTKIWLVAGITDMRNGFNGLAAKVQTALKDDPMSGHVFIFRGRSGSQVKLLWSTGDGLCLLTKRLERGRFAWPS ARDGKVFLTPAQLAMLMEGIDWRQPKRLLTSLTML |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
Z1571 | NP_287075.1 | hypothetical protein | Not tested | TAI | Protein | 4e-47 | 97 |
c3578 | NP_755453.1 | hypothetical protein | Not tested | PAI I CFT073 | Protein | 8e-48 | 97 |
Z4336 | NP_289561.1 | hypothetical protein | Not tested | OI-122 | Protein | 8e-48 | 97 |
Z5097 | NP_290248.1 | prophage-associated protein | Not tested | LEE | Protein | 8e-48 | 97 |
ECs4546 | NP_312573.1 | hypothetical protein | Not tested | LEE | Protein | 8e-48 | 97 |
unnamed | AAC31493.1 | L0014 | Not tested | LEE | Protein | 6e-48 | 97 |
hp4 | AAC61716.1 | Hp4 | Not tested | PAI I CFT073 | Protein | 6e-48 | 97 |
unnamed | AAL99258.1 | unknown | Not tested | LEE | Protein | 6e-48 | 97 |
Z1132 | NP_286667.1 | hypothetical protein | Not tested | TAI | Protein | 4e-47 | 97 |
unnamed | ACU09438.1 | IS66 family element orf2 | Not tested | LEE | Protein | 6e-48 | 97 |
l0014 | CAD33776.1 | L0014 protein | Not tested | PAI I 536 | Protein | 1e-35 | 97 |
c3561 | NP_755436.1 | hypothetical protein | Not tested | PAI I CFT073 | Protein | 4e-48 | 96 |
ECUMN_3327 | YP_002414007.1 | putative transposase ORF2, IS66 family | Not tested | Not named | Protein | 4e-48 | 96 |
unnamed | AAL08461.1 | unknown | Not tested | SRL | Protein | 1e-47 | 95 |
aec52 | AAW51735.1 | Aec52 | Not tested | AGI-3 | Protein | 1e-39 | 77 |
unnamed | ADD91739.1 | hypothetical protein | Not tested | PAI-I AL862 | Protein | 1e-39 | 77 |
pB171ORF50 | CAD66190.1 | ORF50 protein of pB171 | Not tested | PAI III 536 | Protein | 2e-39 | 76 |
ECO103_3553 | YP_003223420.1 | hypothetical protein | Not tested | LEE | Protein | 3e-37 | 72 |
Z4316 | NP_289542.1 | hypothetical protein | Not tested | OI-122 | Protein | 3e-37 | 72 |
BCAM0247 | YP_002232879.1 | putative transposase | Not tested | BcenGI11 | Protein | 2e-29 | 67 |
ECO103_3567 | YP_003223430.1 | hypothetical protein | Not tested | LEE | Protein | 5e-34 | 64 |
Z4338 | NP_289563.1 | hypothetical protein | Not tested | OI-122 | Protein | 5e-34 | 64 |
ECUMN_3364 | YP_002414037.1 | putative transposase ORF2, IS66 family | Not tested | Not named | Protein | 1e-34 | 63 |
Z1160 | NP_286695.1 | hypothetical protein | Not tested | TAI | Protein | 9e-35 | 63 |
Z1599 | NP_287103.1 | hypothetical protein | Not tested | TAI | Protein | 9e-35 | 63 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
EC55989_2249 | YP_002403285.1 | transposase ORF 2, IS66 family | VFG1709 | Protein | 2e-48 | 97 |
EC55989_2249 | YP_002403285.1 | transposase ORF 2, IS66 family | VFG0792 | Protein | 2e-48 | 97 |
EC55989_2249 | YP_002403285.1 | transposase ORF 2, IS66 family | VFG1517 | Protein | 5e-36 | 97 |
EC55989_2249 | YP_002403285.1 | transposase ORF 2, IS66 family | VFG1698 | Protein | 1e-48 | 96 |
EC55989_2249 | YP_002403285.1 | transposase ORF 2, IS66 family | VFG1052 | Protein | 5e-48 | 95 |
EC55989_2249 | YP_002403285.1 | transposase ORF 2, IS66 family | VFG1665 | Protein | 9e-40 | 76 |
EC55989_2249 | YP_002403285.1 | transposase ORF 2, IS66 family | VFG1737 | Protein | 3e-35 | 63 |