Gene Information

Name : yeeT (ECED1_5185)
Accession : YP_002400918.1
Strain : Escherichia coli ED1a
Genome accession: NC_011745
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5116420 - 5116641 bp
Length : 222 bp
Strand : +
Note : Evidence 4 : Homologs of previously reported genes of unknown function; Product type h : extrachromosomal origin

DNA sequence :
ATGAAAATTATCACCCGTGGTGAAGCCATGCGTATTCACCAACAGTACCCTGCATCCCGTCTTTTTCCGTTCTGCACCGG
TAAGTACCGCTGGCACGGCAGCACTGAAGCGTATACCGGTCGTGAGGTGCAGGATATTCCCGGTGTGCTGGCCGTGTTTG
CTGAACGCCGTAAGGACAGTTTTGGCCCGTATGTCCGGCTGATGAGCGTCACCCTGAACTGA

Protein sequence :
MKIITRGEAMRIHQQYPASRLFPFCTGKYRWHGSTEAYTGREVQDIPGVLAVFAERRKDSFGPYVRLMSVTLN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
yeeT AAZ04459.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 3e-30 99
c5151 NP_756999.1 hypothetical protein Not tested PAI II CFT073 Protein 4e-30 99
yeeT ADD91701.1 YeeT Not tested PAI-I AL862 Protein 3e-30 98
unnamed CAD66204.1 hypothetical protein Not tested PAI III 536 Protein 7e-30 98
unnamed CAI43847.1 hypothetical protein Not tested LEE Protein 6e-30 98
unnamed AAL67344.1 intergenic-region protein Not tested PAI II CFT073 Protein 3e-30 98
aec74 AAW51757.1 Aec74 Not tested AGI-3 Protein 1e-29 96
Z1218 NP_286753.1 hypothetical protein Not tested TAI Protein 1e-29 96
unnamed AAL08476.1 unknown Not tested SRL Protein 7e-30 96
yeeT CAD33788.1 YeeT protein Not tested PAI I 536 Protein 4e-30 96
yeeT AAK16199.1 YeeT Not tested PAI-I AL862 Protein 3e-30 96
yeeT NP_838485.1 hypothetical protein Not tested SHI-1 Protein 1e-29 95
yeeT CAD42099.1 hypothetical protein Not tested PAI II 536 Protein 9e-30 95
yeeT NP_708771.1 hypothetical protein Not tested SHI-1 Protein 1e-29 95
yeeT CAE85202.1 YeeT protein Not tested PAI V 536 Protein 1e-29 95
ECO103_3590 YP_003223447.1 hypothetical protein Not tested LEE Protein 2e-29 95
unnamed AAK00480.1 unknown Not tested SHI-1 Protein 1e-25 94
unnamed AAL57578.1 unknown Not tested LEE Protein 1e-27 92
unnamed CAI43902.1 hypothetical protein Not tested LEE Protein 1e-27 92

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yeeT YP_002400918.1 hypothetical protein VFG1679 Protein 3e-30 98
yeeT YP_002400918.1 hypothetical protein VFG1529 Protein 2e-30 96
yeeT YP_002400918.1 hypothetical protein VFG1067 Protein 3e-30 96
yeeT YP_002400918.1 hypothetical protein VFG0661 Protein 4e-30 95
yeeT YP_002400918.1 hypothetical protein VFG1618 Protein 4e-30 95