Gene Information

Name : ECED1_5145 (ECED1_5145)
Accession : YP_002400885.1
Strain : Escherichia coli ED1a
Genome accession: NC_011745
Putative virulence/resistance : Unknown
Product : transposase ORF A, IS911
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 5080979 - 5081323 bp
Length : 345 bp
Strand : +
Note : Evidence 2b : Function of strongly homologous gene; Product type pe : putative enzyme

DNA sequence :
TTGAGGTGGCACACTAAATTTAGCTACCTGAACAGAGGTGATATGCTCACCTCAGAACAACACAGGTGCCATAATGAAAA
AAGAAATTTCAGCGCAGAGTTTAAACGCGAATCCGCTCAATTGGTCGTTGACCAGAAATACACCGTGGCAGATGCAGCCA
GCGCTATGGATGTCGGCCTTTCCACAATGACGCGATGGGTGAAACAATTACGTGATGAGCGGCAGGGAAAAACACCAAAA
ACCTCCCCCATTACCCCGGAACAAATTGAAATCCGTGAGCTCAGGAAAAAGCTACAACGTATTGAAATGGAAAATGAAAT
ATTAAAAAGGCTACCGCGCTCTTGA

Protein sequence :
MRWHTKFSYLNRGDMLTSEQHRCHNEKRNFSAEFKRESAQLVVDQKYTVADAASAMDVGLSTMTRWVKQLRDERQGKTPK
TSPITPEQIEIRELRKKLQRIEMENEILKRLPRS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
l7045 CAD33744.1 - Not tested PAI I 536 Protein 4e-33 95
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 4e-33 95
api80 CAF28554.1 putative transposase Not tested YAPI Protein 2e-32 93
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 3e-32 92
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-25 72
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-25 72
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 8e-26 72
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 8e-26 72
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 8e-26 72
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 8e-26 72
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 8e-26 72
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 8e-26 72
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 4e-23 64
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 8e-18 54
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 6e-18 54
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 6e-17 53
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 1e-17 53
unnamed AAC31483.1 L0004 Not tested LEE Protein 5e-18 48
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 7e-18 48
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 7e-18 48
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 8e-18 47
tnpA CAB61575.1 transposase A Not tested HPI Protein 3e-17 46

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECED1_5145 YP_002400885.1 transposase ORF A, IS911 VFG1485 Protein 1e-33 95
ECED1_5145 YP_002400885.1 transposase ORF A, IS911 VFG1123 Protein 3e-26 72
ECED1_5145 YP_002400885.1 transposase ORF A, IS911 VFG1553 Protein 2e-23 64
ECED1_5145 YP_002400885.1 transposase ORF A, IS911 VFG0784 Protein 2e-18 48