Gene Information

Name : ECED1_4907 (ECED1_4907)
Accession : YP_002400671.1
Strain : Escherichia coli ED1a
Genome accession: NC_011745
Putative virulence/resistance : Unknown
Product : putative transposase ORF2, IS66 family
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 4867561 - 4867911 bp
Length : 351 bp
Strand : -
Note : Evidence 4 : Homologs of previously reported genes of unknown function

DNA sequence :
ATGATCTCGCTCCCATCAGACACTCGAATCTGGCTGGTTGCCGGCGTTACTGATATGCGTAAATCCTTCAACGGTCTGGG
TGAACAGGTACAACATGTGCTGGATGAGACCCCCTTCTCCGGTCACCTGTTCATCTTCCGTGGCCGACGGAGTGACATGA
TTAAAATCCTCTGGGCTGATGCTGATGGTCTGTGCCTGTTCACCAAACGCCTGGAGGAAGGCCAGTTTATCTGGCCTGCG
GTGCGTGACGGTAAGGTATCCATTACCCGCTCGCAGCTGGCAATGCTCCTCGATAAGCTGGACTGGCGTCAGCCAAAAAC
ATCCCGTCTTAACGCACTGACAATGTTGTAA

Protein sequence :
MISLPSDTRIWLVAGVTDMRKSFNGLGEQVQHVLDETPFSGHLFIFRGRRSDMIKILWADADGLCLFTKRLEEGQFIWPA
VRDGKVSITRSQLAMLLDKLDWRQPKTSRLNALTML

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 8e-49 97
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 8e-49 97
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 1e-47 94
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 1e-47 94
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-48 94
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 8e-38 68
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 8e-38 68
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 2e-37 67
unnamed AAL08461.1 unknown Not tested SRL Protein 2e-34 64
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 3e-34 63
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 2e-33 63
unnamed AAL99258.1 unknown Not tested LEE Protein 3e-34 63
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 5e-34 63
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 3e-34 63
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 5e-34 63
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-34 63
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 4e-34 63
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 4e-34 63
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 4e-34 63
unnamed AAC31493.1 L0014 Not tested LEE Protein 3e-34 63
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 2e-33 63
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 9e-26 62
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 5e-35 61
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 5e-35 61
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 2e-28 58

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECED1_4907 YP_002400671.1 putative transposase ORF2, IS66 family VFG1737 Protein 4e-49 94
ECED1_4907 YP_002400671.1 putative transposase ORF2, IS66 family VFG1665 Protein 9e-38 67
ECED1_4907 YP_002400671.1 putative transposase ORF2, IS66 family VFG1052 Protein 8e-35 64
ECED1_4907 YP_002400671.1 putative transposase ORF2, IS66 family VFG0792 Protein 1e-34 63
ECED1_4907 YP_002400671.1 putative transposase ORF2, IS66 family VFG1698 Protein 1e-34 63
ECED1_4907 YP_002400671.1 putative transposase ORF2, IS66 family VFG1709 Protein 1e-34 63
ECED1_4907 YP_002400671.1 putative transposase ORF2, IS66 family VFG1517 Protein 4e-26 62