Gene Information

Name : yeeU (ECED1_4875)
Accession : YP_002400646.1
Strain : Escherichia coli ED1a
Genome accession: NC_011745
Putative virulence/resistance : Virulence
Product : CP4-44 prophage YeeV-YeeU toxin-antitoxin system toxin
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4839649 - 4840017 bp
Length : 369 bp
Strand : -
Note : Evidence 1b : Function experimentally demonstrated in the studied species; PubMedId : 14594833; Product type h : extrachromosomal origin

DNA sequence :
GTGTCAGACGCACTCTCCGGGACAATGCTTCCCGACGACAATCACGACCGCCCCTGGTGGGGGCTGCCCTGCACCGTGAC
GCCCTGTTTCGGGGCACGTCTGGTGCAGGAGGGTAACCGCCTGCATTACCTTGCCGACCGCGCCGGTATCAGAGGCCTGT
TCAGCGATGCAGATGCGTACCACCTGGACCAGGCCTTTCCGCTGCTGATGAAACAACTGGAACTCATGCTCACCAGCGGT
GAACTGAATCCCCGCCATCAGCATACCGTCACGCTGTATGCAAAAGGTCTGACCTGCAAAGCTGACACTCTCGGTAGCGG
TGGTTACGTTTATCTGGCTGTTTATCCGACGCCCGAAACGAAAAAGTAA

Protein sequence :
MSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD66206.1 hypothetical protein Not tested PAI III 536 Protein 4e-54 100
yeeU YP_853121.1 antitoxin of the YeeV-YeeU toxin-antitoxin system Virulence PAI IV APEC-O1 Protein 4e-51 95
aec75 AAW51758.1 Aec75 Not tested AGI-3 Protein 2e-49 94
yeeU CAD42100.1 hypothetical protein Not tested PAI II 536 Protein 5e-49 92
c5150 NP_756998.1 hypothetical protein Not tested PAI II CFT073 Protein 6e-49 92
yeeU ADD91700.1 YeeU Not tested PAI-I AL862 Protein 3e-48 91
yeeU NP_838486.1 structural protein Not tested SHI-1 Protein 2e-48 91
yeeU NP_708772.1 structural protein Not tested SHI-1 Protein 2e-48 91
yeeU CAE85203.1 YeeU protein Not tested PAI V 536 Protein 3e-48 91
yeeU YP_854324.1 hypothetical protein Not tested PAI I APEC-O1 Protein 2e-48 91
yeeU AAZ04460.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 1e-48 91
Z1220 NP_286755.1 structural protein Not tested TAI Protein 5e-46 90
Z1658 NP_287161.1 structural protein Not tested TAI Protein 5e-46 90
unnamed AAK00481.1 unknown Not tested SHI-1 Protein 3e-48 90
unnamed CAI43903.1 hypothetical protein Not tested LEE Protein 3e-48 90
ECO103_3591 YP_003223448.1 hypothetical protein Not tested LEE Protein 9e-46 89
unnamed AAL67343.1 intergenic-region protein Not tested PAI II CFT073 Protein 4e-46 89
unnamed AAL08477.1 unknown Not tested SRL Protein 8e-46 88
unnamed AAL57576.1 unknown Not tested LEE Protein 6e-48 88

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yeeU YP_002400646.1 CP4-44 prophage YeeV-YeeU toxin-antitoxin system toxin VFG1681 Protein 1e-54 100
yeeU YP_002400646.1 CP4-44 prophage YeeV-YeeU toxin-antitoxin system toxin VFG1619 Protein 2e-49 92
yeeU YP_002400646.1 CP4-44 prophage YeeV-YeeU toxin-antitoxin system toxin VFG0662 Protein 5e-49 91
yeeU YP_002400646.1 CP4-44 prophage YeeV-YeeU toxin-antitoxin system toxin VFG1068 Protein 3e-46 88