Name : ECED1_3320 (ECED1_3320) Accession : YP_002399199.1 Strain : Escherichia coli ED1a Genome accession: NC_011745 Putative virulence/resistance : Virulence Product : putative regulatory protein from prophage (AlpA family) Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 3262451 - 3262654 bp Length : 204 bp Strand : - Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type h : extrachromosomal origin DNA sequence : ATGGCTAATAACAATTCATTCATCCGTCTTTCTGAGGTTATGCGCCGTACTGGTTACGGTCGCGCATGGATTTATCGCCT GATCAGCCTGGGGCGCTTCCCTAAACCGGTAAAAATTGGTCCCCGCTCCGTGGCTTTTATTGAAAGTGAAGTCGACGAAT GGATTAACCAGCGTATTGATGCTTCTCGCAACAACGCCGCGTAA Protein sequence : MANNNSFIRLSEVMRRTGYGRAWIYRLISLGRFPKPVKIGPRSVAFIESEVDEWINQRIDASRNNAA |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
unnamed | CAB46594.1 | DNA-binding protein | Not tested | HPI | Protein | 5e-07 | 48 |
unnamed | CAA21398.1 | - | Not tested | HPI | Protein | 8e-07 | 48 |
VC1785 | NP_231420.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 1e-07 | 48 |
VC0395_A1382 | YP_001217325.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 1e-07 | 48 |
VPI2_0033 | AAX20900.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 8e-08 | 48 |
VPI2_0041 | ACA01856.1 | predicted transcriptional regulator | Not tested | VPI-2 | Protein | 1e-08 | 46 |
VC1809 | NP_231443.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-08 | 46 |
VC0395_A1406 | YP_001217349.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-08 | 46 |
Z1188 | NP_286723.1 | hypothetical protein | Not tested | TAI | Protein | 2e-04 | 43 |
Z1627 | NP_287131.1 | hypothetical protein | Not tested | TAI | Protein | 2e-04 | 43 |
PMI2608 | YP_002152324.1 | prophage regulatory protein | Not tested | Not named | Protein | 1e-05 | 42 |
VC0497 | NP_230151.1 | transcriptional regulator | Not tested | VSP-2 | Protein | 2e-07 | 42 |
unnamed | CAD33739.1 | hypothetical protein | Not tested | PAI I 536 | Protein | 7e-08 | 42 |
c5192 | NP_757040.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 9e-08 | 42 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
ECED1_3320 | YP_002399199.1 | putative regulatory protein from prophage (AlpA family) | VFG1118 | Protein | 3e-08 | 48 |
ECED1_3320 | YP_002399199.1 | putative regulatory protein from prophage (AlpA family) | VFG1141 | Protein | 5e-09 | 46 |
ECED1_3320 | YP_002399199.1 | putative regulatory protein from prophage (AlpA family) | VFG1480 | Protein | 3e-08 | 42 |