Gene Information

Name : ECED1_2322 (ECED1_2322)
Accession : YP_002398256.1
Strain : Escherichia coli ED1a
Genome accession: NC_011745
Putative virulence/resistance : Virulence
Product : putative DNA binding protein from phage origin
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 2265335 - 2265553 bp
Length : 219 bp
Strand : -
Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type h : extrachromosomal origin

DNA sequence : 
ATGGTTCAAAACAAAACAGATAAAACTTTAAAACTTATTCGCTTATCAGAAGTAATAAGGAAAACCGGGTTCGGCAAAAC
GTGGATTTATAAACTTATCAGCGCGGGGAAATTCCCCAAACAAATAAAAATCGGTGACAGAGCTGTTGCTTTCATTGAAA
GCGAAGTTGATGAGTGGATTTATAAAGCTATAACTGCTTCTCGTAATACATCTAACTAA

Protein sequence : 
MVQNKTDKTLKLIRLSEVIRKTGFGKTWIYKLISAGKFPKQIKIGDRAVAFIESEVDEWIYKAITASRNTSN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
PMI2608 YP_002152324.1 prophage regulatory protein Not tested Not named Protein 4e-05 48
unnamed CAB46594.1 DNA-binding protein Not tested HPI Protein 5e-07 47
unnamed CAA21398.1 - Not tested HPI Protein 8e-07 47
VC0497 NP_230151.1 transcriptional regulator Not tested VSP-2 Protein 1e-06 43
VC0395_A1406 YP_001217349.1 transcriptional regulator Not tested VPI-2 Protein 5e-10 42
VPI2_0041 ACA01856.1 predicted transcriptional regulator Not tested VPI-2 Protein 3e-10 42
VC1809 NP_231443.1 transcriptional regulator Not tested VPI-2 Protein 5e-10 42
unnamed CAD33739.1 hypothetical protein Not tested PAI I 536 Protein 4e-06 41
c5192 NP_757040.1 hypothetical protein Not tested PAI II CFT073 Protein 6e-06 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECED1_2322 YP_002398256.1 putative DNA binding protein from phage origin VFG1141 Protein 1e-10 42
ECED1_2322 YP_002398256.1 putative DNA binding protein from phage origin VFG1480 Protein 2e-06 41