Gene Information

Name : ECED1_1797 (ECED1_1797)
Accession : YP_002397756.1
Strain : Escherichia coli ED1a
Genome accession: NC_011745
Putative virulence/resistance : Virulence
Product : putative phage regulatory protein
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 1754225 - 1754413 bp
Length : 189 bp
Strand : -
Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type h : extrachromosomal origin

DNA sequence : 
GTGTTAAGCACTGATCGGTTTATACGTGAAAAAGAATGCGAAAAGCTAACAGGCCTTAGCCGCTCATGCCGCTACCGCCT
GGAAAAGGCCGGACAATTCCCATCACGTCGTAAACTTGGCGGTCGTTCCGTTGGCTGGTCTTTATCCGAGGTTCTGGCCT
GGAAGGATAGCTGCAAGGCAGTTCATTAA

Protein sequence : 
MLSTDRFIREKECEKLTGLSRSCRYRLEKAGQFPSRRKLGGRSVGWSLSEVLAWKDSCKAVH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
VPI2_0033 AAX20900.1 transcriptional regulator Not tested VPI-2 Protein 2e-06 46
VC1785 NP_231420.1 transcriptional regulator Not tested VPI-2 Protein 3e-06 46
VC0395_A1382 YP_001217325.1 transcriptional regulator Not tested VPI-2 Protein 3e-06 46
VC0497 NP_230151.1 transcriptional regulator Not tested VSP-2 Protein 2e-06 44
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 0.11 42
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 0.11 42
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 0.079 42
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 0.068 42
ORF SG104 AAN62325.1 phage-related protein Not tested PAGI-3(SG) Protein 4e-05 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECED1_1797 YP_002397756.1 putative phage regulatory protein VFG1118 Protein 8e-07 46
ECED1_1797 YP_002397756.1 putative phage regulatory protein VFG0651 Protein 0.032 42