Gene Information

Name : bla (pEFER_0036)
Accession : YP_002394583.1
Strain :
Genome accession: NC_011743
Putative virulence/resistance : Resistance
Product : Beta-lactamase TEM precursor (Penicillinase)
Function : -
COG functional category : V : Defense mechanisms
COG ID : COG2367
EC number : 3.5.2.6
Position : 38285 - 39145 bp
Length : 861 bp
Strand : +
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 358200, 3019092, 15769331; Product type e : enzyme

DNA sequence :
ATGAGTATTCAACATTTTCGTGTCGCCCTTATTCCCTTTTTTGCGGCATTTTGCCTTCCTGTTTTTGCTCACCCAGAAAC
GCTGGTGAAAGTAAAAGATGCTGAAGATCAGTTGGGTGCACGAGTGGGTTACATCGAACTGGATCTCAACAGCGGTAAGA
TCCTTGAGAGTTTTCGCCCCGAAGAACGTTTTCCAATGATGAGCACTTTTAAAGTTCTGCTATGTGGTGCGGTATTATCC
CGTGTTGACGCCGGGCAAGAGCAACTCGGTCGCCGCATACACTATTCTCAGAATGACTTGGTTGAGTACTCACCAGTCAC
AGAAAAGCATCTTACGGATGGCATGACAGTAAGAGAATTATGCAGTGCTGCCATAACCATGAGTGATAACACTGCTGCCA
ACTTACTTCTGACAACGATCGGAGGACCGAAGGAGCTAACCGCTTTTTTGCACAACATGGGGGATCATGTAACTCGCCTT
GATCGTTGGGAACCGGAGCTGAATGAAGCCATACCAAACGACGAGCGTGACACCACGATGCCTGCAGCAATGGCAACAAC
GTTGCGCAAACTATTAACTGGCGAACTACTTACTCTAGCTTCCCGGCAACAATTAATAGACTGGATGGAGGCGGATAAAG
TTGCAGGACCACTTCTGCGCTCGGCCCTTCCGGCTGGCTGGTTTATTGCTGATAAATCTGGAGCCGGTGAGCGTGGGTCT
CGCGGTATCATTGCAGCACTGGGGCCAGATGGTAAGCCCTCCCGTATCGTAGTTATCTACACGACGGGGAGTCAGGCAAC
TATGGATGAACGAAATAGACAGATCGCTGAGATAGGTGCCTCACTGATTAAGCATTGGTAA

Protein sequence :
MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLS
RVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRL
DRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS
RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
blaTEM AFV53104.1 TEM-1 beta-lactamase Not tested AbGRI2-1 Protein 1e-125 100
blaTEM-1b ACK44542.1 BlaTEM-1b beta lactamase Not tested SGI1 Protein 1e-125 100
blaTEM-1b ACF06168.1 beta-lactamase TEM-1b Not tested Tn5036-like Protein 1e-125 100
blaTEM-1 ADI24150.1 beta-lactamase TEM-1 Not tested AbaR1 Protein 1e-125 100
blaTEM-1b AGK07035.1 TEM-1b beta lactamase Not tested SGI1 Protein 1e-125 100
blaTEM-1b AGK07093.1 TEM-1b beta lactamase Not tested SGI1 Protein 1e-125 100
ABTW07_3874 YP_005797122.1 beta-lactamase TEM Not tested AbaR4e Protein 2e-125 100
pse-1 AAK02055.1 beta-lactamase Not tested SGI1 Protein 3e-42 44
pse-1 AGK06978.1 PSE-1 beta-lactamase Not tested SGI1 Protein 3e-42 44
pse-1 AGK07108.1 PSE-1 beta-lactamase Not tested SGI1 Protein 3e-42 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) FQ312006.1.gene118.p Protein 8e-126 100
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) NC_011586.7045197.p0 Protein 8e-126 100
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) HQ451074.1.gene4.p01 Protein 8e-126 100
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) NC_010558.1.6276043. Protein 8e-126 100
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY327539.1.gene1.p01 Protein 2e-122 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY327540.1.gene1.p01 Protein 3e-118 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY574271.1.gene1.p01 Protein 3e-124 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AJ277415.1.gene1.p01 Protein 1e-123 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) U95363.2.gene1.p01 Protein 2e-120 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) GU371926.1.gene94.p0 Protein 2e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY130282.1.gene1.p1 Protein 1e-109 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) DQ286729.1.gene1.p1 Protein 3e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF190695.1.gene1.p01 Protein 6e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) Y10279.1.gene1.p01 Protein 1e-124 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) DQ075245.1.gene1.p01 Protein 2e-124 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) X65253.1.gene1.p01 Protein 6e-124 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF397066.1.gene1.p1 Protein 4e-123 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AM183304.1.gene1.p01 Protein 9e-126 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) DQ369751.1.gene1.p01 Protein 1e-119 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF351241.1.gene1.p01 Protein 2e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) JN254627.1.gene1.p01 Protein 4e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF190692.1.gene1.p01 Protein 8e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY589495.1.gene1.p01 Protein 2e-124 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) FJ360884.1.gene1.p01 Protein 1e-123 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AJ318093.1.gene1.p01 Protein 1e-120 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) GU550123.1.gene1.p1 Protein 1e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY130285.1.gene1.p1 Protein 3e-112 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF347054.1.gene1.p1 Protein 3e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF427128.1.gene1.p01 Protein 6e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY853593.1.gene1.p1 Protein 1e-124 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF427129.1.gene1.p01 Protein 3e-123 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF157553.1.gene1.p1 Protein 3e-120 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) Y14574.2.gene1.p01 Protein 2e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AM849805.1.gene1.p01 Protein 4e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF104442.1.gene1.p01 Protein 8e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) DQ072853.1.gene1.p01 Protein 1e-124 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) DQ834728.1.gene1.p1 Protein 2e-124 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AJ277414.1.gene1.p01 Protein 9e-124 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY101578.1.gene1.p01 Protein 6e-121 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF190694.1.gene1.p01 Protein 1e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF250872.1.gene1.p1 Protein 7e-119 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY307100.1.gene1.p1 Protein 3e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) X57972.1.gene1.p1 Protein 6e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) X64523.1.gene1.p01 Protein 1e-124 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) Y10280.1.gene1.p01 Protein 4e-124 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY101764.1.gene1.p01 Protein 3e-120 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) DQ909059.1.gene1.p1 Protein 2e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) HQ529916.1.gene1.p01 Protein 4e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY491682.1.gene1.p1 Protein 7e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY628175.1.gene1.p01 Protein 1e-124 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) DQ679961.1.gene1.p01 Protein 2e-124 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AJ866988.1.gene1.p01 Protein 7e-124 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY628199.1.gene1.p01 Protein 2e-121 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF516720.1.gene1.p1 Protein 1e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AB049569.1.gene1.p01 Protein 1e-119 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY368236.1.gene1.p1 Protein 2e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) DQ105529.2.gene1.p01 Protein 5e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF535127.1.gene1.p01 Protein 9e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY528425.1.gene1.p1 Protein 4e-124 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY628176.1.gene1.p01 Protein 1e-123 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY039040.1.gene1.p01 Protein 2e-120 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) X54606.1.gene1.p01 Protein 2e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) JF949916.1.gene1.p01 Protein 7e-109 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY956335.1.gene1.p1 Protein 3e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY243512.1.gene1.p01 Protein 7e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) DQ834729.1.gene1.p1 Protein 1e-124 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) JN211012.1.gene1.p01 Protein 2e-124 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) FJ873740.1.gene1.p01 Protein 6e-124 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY368237.1.gene1.p1 Protein 9e-126 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY436361.1.gene1.p01 Protein 1e-119 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF427127.1.gene1.p01 Protein 2e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) EF136377.1.gene1.p01 Protein 5e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF093512.1.gene1.p01 Protein 8e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) EU815939.1.gene1.p1 Protein 2e-124 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF091113.2.gene1.p01 Protein 1e-123 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) Y13612.1.gene1.p01 Protein 1e-120 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF516719.1.gene1.p1 Protein 1e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY130284.1.gene1.p1 Protein 1e-111 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) FJ405211.1.gene1.p01 Protein 3e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) FJ807656.1.gene1.p01 Protein 6e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY826417.1.gene1.p01 Protein 1e-124 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) Y17582.1.gene1.p01 Protein 5e-124 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF397067.1.gene1.p1 Protein 4e-123 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF332513.1.gene1.p01 Protein 9e-120 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY092401.1.gene1.p1 Protein 2e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF203816.1.gene1.p01 Protein 4e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) FJ197316.1.gene1.p1 Protein 8e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) Y17583.1.gene1.p01 Protein 2e-124 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF468003.1.gene1.p1 Protein 2e-124 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF397068.1.gene1.p1 Protein 1e-123 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY027590.1.gene1.p1 Protein 1e-120 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AM087454.1.gene1.p01 Protein 1e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF188199.1.gene1.p01 Protein 3e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) U37195.1.gene1.p1 Protein 6e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AM286274.1.gene1.p01 Protein 1e-124 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AM049399.1.gene1.p01 Protein 5e-124 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) HM246246.1.gene1.p1 Protein 2e-123 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY589494.1.gene1.p01 Protein 3e-120 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AJ308558.1.gene1.p01 Protein 2e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) DQ279850.1.gene1.p1 Protein 4e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF190693.1.gene1.p01 Protein 8e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF104441.1.gene1.p01 Protein 1e-124 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF495873.1.gene1.p1 Protein 2e-124 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) Y10281.1.gene1.p01 Protein 7e-124 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) Y17581.1.gene1.p01 Protein 4e-121 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) JN227084.1.gene1.p01 Protein 1e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) FJ919776.1.gene1.p01 Protein 2e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY874537.1.gene1.p01 Protein 6e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY072920.1.gene1.p1 Protein 9e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF506748.1.gene1.p1 Protein 4e-124 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AJ239002.1.gene1.p01 Protein 1e-123 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) EF136376.1.gene1.p01 Protein 3e-120 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AM941159.1.gene1.p01 Protein 2e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) JF949915.1.gene1.p01 Protein 2e-108 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) DQ105528.2.gene1.p01 Protein 3e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY589493.1.gene1.p01 Protein 7e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) X65254.1.gene1.p01 Protein 1e-124 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AJ746225.1.gene1.p01 Protein 2e-124 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) JN416112.1.gene1.p01 Protein 7e-124 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AJ634602.gene.p01 Protein 2e-121 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF427130.1.gene1.p01 Protein 1e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AJ318094.1.gene1.p01 Protein 1e-119 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) Y17584.1.gene1.p01 Protein 2e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) EU274580.1.gene1.p1 Protein 5e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) EF534736.1.gene1.p01 Protein 9e-125 99
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) EF468463.1.gene1.p01 Protein 5e-124 98
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY271267.1.gene1.p01 Protein 2e-123 98
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) FN652295.1.gene1.p01 Protein 4e-119 98
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY590467.1.gene1.p1 Protein 2e-77 67
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) Y11069.1.gene1.p01 Protein 5e-82 67
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF299299.1.gene1.p01 Protein 1e-88 67
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AM176558.2.gene1.p01 Protein 1e-88 67
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) JN051143.1.gene1.p01 Protein 4e-89 67
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) EU418913.1.gene1.p01 Protein 9e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY259119.1.gene1.p1 Protein 2e-88 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) EF373972.1.gene1.p01 Protein 3e-88 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) EU586041.1.gene1.p01 Protein 2e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AJ866284.2.gene1.p01 Protein 4e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) U92041.1.gene1.p01 Protein 1e-88 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) JX268752.1.gene1.p01 Protein 1e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY277255.2.gene1.p01 Protein 3e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) HQ661362.1.gene1.p1 Protein 7e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AJ866285.2.gene1.p01 Protein 2e-88 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AM176554.2.gene1.p01 Protein 2e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF208796.2.gene1.p01 Protein 3e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF226622.1.gene1.p01 Protein 9e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AM176553.2.gene1.p01 Protein 2e-88 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) JQ029959.1.gene1.p01 Protein 1e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AM176557.2.gene1.p01 Protein 2e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF467948.1.gene1.p1 Protein 5e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AM176550.2.gene1.p01 Protein 1e-88 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) DQ174307.1.gene1.p01 Protein 3e-88 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF535128.1.gene1.p01 Protein 1e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) DQ013287.1.gene1.p1 Protein 3e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) DQ174305.1.gene1.p01 Protein 8e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY263404.1.gene1.p1 Protein 1e-88 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AB023477.1.gene1.p01 Protein 2e-88 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) DQ174308.1.gene1.p01 Protein 7e-90 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AM176556.2.gene1.p01 Protein 2e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) DQ193536.1.gene1.p01 Protein 4e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY079099.1.gene1.p01 Protein 1e-88 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF293345.1.gene1.p01 Protein 2e-88 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) JX013655.1.gene1.p01 Protein 8e-88 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) HQ637576.1.gene1.p01 Protein 1e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AM176552.2.gene1.p01 Protein 3e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) EU342351.1.gene1.p01 Protein 9e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) EU024485.1.gene1.p01 Protein 2e-88 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF535129.1.gene1.p01 Protein 3e-88 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF164577.1.gene1.p01 Protein 2e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) JF812965.1.gene1.p01 Protein 2e-88 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY289548.1.gene1.p01 Protein 7e-88 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) CP000647.1.gene1607. Protein 1e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) EF373970.1.gene1.p01 Protein 3e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) GQ428198.1.gene1.p01 Protein 7e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY661885.1.gene1.p01 Protein 2e-88 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AB551737.1.gene1.p01 Protein 3e-88 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF467947.1.gene1.p1 Protein 2e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY070258.1.gene1.p1 Protein 4e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF148850.1.gene1.p01 Protein 9e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF148851.1.gene1.p01 Protein 2e-88 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AM176551.2.gene1.p01 Protein 1e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) DQ174304.1.gene1.p01 Protein 3e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) EU032604.1.gene1.p01 Protein 1e-88 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY528718.1.gene1.p01 Protein 3e-88 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AM176546.2.gene1.p01 Protein 1e-87 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) DQ322460.1.gene1.p1 Protein 2e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) HQ877615.1.gene1.p01 Protein 3e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) FJ668814.gene1.p01 Protein 9e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF227204.1.gene1.p01 Protein 1e-88 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) EU155018.1.gene1.p01 Protein 2e-88 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AM176555.2.gene1.p01 Protein 7e-90 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) X98102.1.gene1.p01 Protein 2e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AM176547.2.gene1.p01 Protein 5e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) JX268631.1.gene1.p01 Protein 3e-88 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY223863.1.gene1.p01 Protein 8e-88 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AM176549.2.gene1.p01 Protein 1e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) HM751100.1.gene1.p01 Protein 3e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) EF373973.1.gene1.p01 Protein 2e-88 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) EF373971.1.gene1.p01 Protein 2e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) HQ661363.1.gene1.p1 Protein 1e-88 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY790341.1.gene1.p01 Protein 2e-88 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AB302939.1.gene1.p01 Protein 1e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) EU274581.1.gene1.p1 Protein 3e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF317502.gene.p01 Protein 4e-80 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AM176548.2.gene1.p01 Protein 8e-89 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) DQ054528.1.gene1.p01 Protein 5e-88 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) DQ328802.1.gene1.p01 Protein 1e-88 66
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AJ920369.1.gene1.p01 Protein 8e-86 65
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AM087453.1.gene1.p01 Protein 4e-85 65
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AB733453.1.gene1.p01 Protein 5e-85 65
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY037780.1.gene1.p01 Protein 2e-88 65
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF535130.1.gene1.p01 Protein 3e-88 65
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF547625.1.gene1.p1 Protein 1e-87 65
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF301532.1.gene1.p01 Protein 1e-88 65
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) U20270.1.gene1.p01 Protein 5e-88 65
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) GU827715.1.gene1.p01 Protein 1e-87 65
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY518560.gene.p01 Protein 4e-88 65
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) DQ836922.1.gene1.p01 Protein 8e-89 65
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) EF373969.1.gene1.p01 Protein 4e-89 65
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) FJ194944.1.gene1.p01 Protein 2e-87 65
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) EU684753.1.gene1.p01 Protein 5e-88 65
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) HM559945.1.gene1.p01 Protein 6e-89 65
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY210887.1.gene1.p1 Protein 4e-88 65
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY288915.1.gene1.p01 Protein 1e-88 65
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) DQ174306.1.gene1.p01 Protein 8e-89 65
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) X55640.1.gene1.p01 Protein 4e-88 65
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) JQ388884.1.gene1.p1 Protein 8e-88 65
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) GU932590.1.gene1.p1 Protein 5e-86 64
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) U14748.1.gene2.p01 Protein 2e-44 47
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF135373.1.gene1.p01 Protein 2e-56 46
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY178993.1.gene1.p01 Protein 2e-56 46
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY123251.gene6.p01 Protein 5e-42 45
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF313471.1.gene2.p01 Protein 9e-43 44
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) EU729727.1.gene1.p1 Protein 3e-39 44
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) FJ234412.1.gene1.p01 Protein 1e-39 44
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) GQ140348.1.gene1.p01 Protein 3e-39 44
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF395881.gene.p01 Protein 3e-39 44
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF030945.1.gene1.p01 Protein 2e-42 43
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY008290.1.gene1.p1 Protein 2e-42 43
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) S46063.1.gene1.p2 Protein 6e-44 43
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AB126603.gene.p01 Protein 8e-44 43
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) EU555534.1.gene1.p01 Protein 1e-39 43
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) HQ641421.1.gene1.p01 Protein 3e-39 43
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AY034847.1.gene1.p01 Protein 2e-39 43
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) HM066995.1.gene1.p01 Protein 4e-39 43
bla YP_002394583.1 Beta-lactamase TEM precursor (Penicillinase) AF297554.1.gene1.p1 Protein 1e-39 43