Gene Information

Name : ECS88_4855 (ECS88_4855)
Accession : YP_002394339.1
Strain : Escherichia coli S88
Genome accession: NC_011742
Putative virulence/resistance : Unknown
Product : transposase ORF A, IS3 family
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 4822907 - 4823293 bp
Length : 387 bp
Strand : +
Note : Evidence 2b : Function of strongly homologous gene; Product type pe : enzyme

DNA sequence :
GTGATATGCTCACCTCAGAACAACACAGGTGCTCCAATGAAAAAAAGAAATTTTAGCGCAGAGTTTAAACGCGAATCCGC
TCAACTGGTTGTTGACCAGACATACACGGTGGCAGATGCCGCCAAAGCTATGGATGTTGGCCTTTCCACAATGACAAGAT
GGGTCAAACAACTGCGTGATGAGCGTCAGGGCAAAACACCAAAAGCCTCTCCGATAACACCAGAACAAATCGAAATACGT
AAGCTGAGGAAAAAGCTACAACGCATTGAAATGGAGAATGAAATATTAAAAAAGGCTACTGTAGATTCAATCTGTCAATG
CAACACCCCTTTCAATTATCTCTTTCGGTGTTTTGAACTTCAGTGTCTTTCTCGGTCTGTTGTTTAG

Protein sequence :
MICSPQNNTGAPMKKRNFSAEFKRESAQLVVDQTYTVADAAKAMDVGLSTMTRWVKQLRDERQGKTPKASPITPEQIEIR
KLRKKLQRIEMENEILKKATVDSICQCNTPFNYLFRCFELQCLSRSVV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
l7045 CAD33744.1 - Not tested PAI I 536 Protein 9e-36 90
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 9e-36 90
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 3e-34 87
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-29 65
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-29 65
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-29 65
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-29 65
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-29 65
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-29 65
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-29 65
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-29 65
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 1e-24 61
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 3e-20 54
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 2e-20 54
unnamed AAC31483.1 L0004 Not tested LEE Protein 8e-21 53
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 1e-20 53
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 1e-20 53
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 2e-17 53
tnpA CAB61575.1 transposase A Not tested HPI Protein 6e-19 46
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 2e-18 45
Z1150 NP_286685.1 hypothetical protein Not tested TAI Protein 9e-17 41
Z1589 NP_287093.1 hypothetical protein Not tested TAI Protein 9e-17 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECS88_4855 YP_002394339.1 transposase ORF A, IS3 family VFG1485 Protein 4e-36 90
ECS88_4855 YP_002394339.1 transposase ORF A, IS3 family VFG1123 Protein 4e-30 65
ECS88_4855 YP_002394339.1 transposase ORF A, IS3 family VFG1553 Protein 5e-25 61
ECS88_4855 YP_002394339.1 transposase ORF A, IS3 family VFG0784 Protein 4e-21 53