Gene Information

Name : ECS88_4703 (ECS88_4703)
Accession : YP_002394193.1
Strain : Escherichia coli S88
Genome accession: NC_011742
Putative virulence/resistance : Unknown
Product : transposase ORF A, IS3 family
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 4670442 - 4670765 bp
Length : 324 bp
Strand : -
Note : Evidence 2b : Function of strongly homologous gene; Product type pe : enzyme

DNA sequence :
GTGATATGCTCACCTCAGAACAACACAGGTGCTCCAATGAAAAAAAGAAATTTTAGCGCAGAGTTTAAACGCGAATCCGC
TCAACTGGTTGTTGACCAGAAATACACGGTGGCAGATGCCGCCAAAGCTATGGATGTTGGCCTTTCCACAATGACAAGAT
GGGTCAAACAACTGCGTGATGAGCGTCAGGGCAAAACACCAAAAGCCTCTCCGATAACACCAGAACAAATCGAAATACGT
AAGCTGAGGAAAAAGCTACAACGCATTGAAATGGAGAATGAAATATTAAAAAAGGCGGCGTACTTCGCAAAGCTGTCCGA
CTGA

Protein sequence :
MICSPQNNTGAPMKKRNFSAEFKRESAQLVVDQKYTVADAAKAMDVGLSTMTRWVKQLRDERQGKTPKASPITPEQIEIR
KLRKKLQRIEMENEILKKAAYFAKLSD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
l7045 CAD33744.1 - Not tested PAI I 536 Protein 3e-35 96
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 3e-35 96
api80 CAF28554.1 putative transposase Not tested YAPI Protein 9e-34 93
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 8e-34 93
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-29 68
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-29 68
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-29 68
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 5e-29 68
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-29 68
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 5e-29 68
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-29 68
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 4e-29 68
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 3e-24 65
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 3e-20 54
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 4e-20 54
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 4e-18 54
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 2e-20 53
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 2e-20 53
unnamed AAC31483.1 L0004 Not tested LEE Protein 1e-20 53
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 2e-17 52
tnpA CAB61575.1 transposase A Not tested HPI Protein 1e-20 48
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 3e-20 47
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 3e-11 44
unnamed CAD33780.1 putative transposase Not tested PAI I 536 Protein 4e-10 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECS88_4703 YP_002394193.1 transposase ORF A, IS3 family VFG1485 Protein 1e-35 96
ECS88_4703 YP_002394193.1 transposase ORF A, IS3 family VFG1123 Protein 1e-29 68
ECS88_4703 YP_002394193.1 transposase ORF A, IS3 family VFG1553 Protein 1e-24 65
ECS88_4703 YP_002394193.1 transposase ORF A, IS3 family VFG0784 Protein 5e-21 53
ECS88_4703 YP_002394193.1 transposase ORF A, IS3 family VFG1566 Protein 1e-11 44
ECS88_4703 YP_002394193.1 transposase ORF A, IS3 family VFG1521 Protein 2e-10 41