Gene Information

Name : soxS (ECS88_4551)
Accession : YP_002394058.1
Strain : Escherichia coli S88
Genome accession: NC_011742
Putative virulence/resistance : Resistance
Product : DNA-binding transcriptional regulator SoxS
Function : -
COG functional category : K : Transcription
COG ID : COG2207
EC number : -
Position : 4532662 - 4532985 bp
Length : 324 bp
Strand : -
Note : regulates genes involved in response to oxidative stress

DNA sequence :
ATGTCCCATCAGAAAATTATTCAGGATCTTATCGCATGGATTGACGAGCATATTGACCAGCCGCTTAACATTGATGTCGT
CGCAAAAAAATCTGGCTATTCAAAGTGGTACTTGCAACGGATGTTCCGCACGGTGACGCATCAGACGCTTGGCGATTACA
TTCGCCAGCGCCGTCTGTTACTGGCCGCCGTTGAGTTGCGCACCACCGAGCGTCCGATTTTTGATATCGCAATGGACCTG
GGTTATGTCTCTCAGCAGACCTTCTCCCGCGTTTTCCGTCGGCAGTTTGATCGCACTCCCAGCGATTATCGCCACCGCCT
GTAG

Protein sequence :
MSHQKIIQDLIAWIDEHIDQPLNIDVVAKKSGYSKWYLQRMFRTVTHQTLGDYIRQRRLLLAAVELRTTERPIFDIAMDL
GYVSQQTFSRVFRRQFDRTPSDYRHRL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 2e-45 96
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 9e-22 51
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 9e-22 51

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
soxS YP_002394058.1 DNA-binding transcriptional regulator SoxS NC_002695.1.914293.p Protein 4e-47 100
soxS YP_002394058.1 DNA-binding transcriptional regulator SoxS BAC0371 Protein 4e-47 100
soxS YP_002394058.1 DNA-binding transcriptional regulator SoxS CP000034.1.gene4505. Protein 7e-47 99
soxS YP_002394058.1 DNA-binding transcriptional regulator SoxS CP001138.1.gene4488. Protein 7e-46 96
soxS YP_002394058.1 DNA-binding transcriptional regulator SoxS CP001918.1.gene327.p Protein 6e-44 90
soxS YP_002394058.1 DNA-binding transcriptional regulator SoxS CP000647.1.gene4499. Protein 2e-43 89
soxS YP_002394058.1 DNA-binding transcriptional regulator SoxS NC_010558.1.6276025. Protein 4e-22 51
soxS YP_002394058.1 DNA-binding transcriptional regulator SoxS CP001138.1.gene612.p Protein 5e-24 46
soxS YP_002394058.1 DNA-binding transcriptional regulator SoxS CP000647.1.gene1624. Protein 8e-20 43
soxS YP_002394058.1 DNA-binding transcriptional regulator SoxS CP001918.1.gene2033. Protein 1e-19 43
soxS YP_002394058.1 DNA-binding transcriptional regulator SoxS CP001138.1.gene1637. Protein 2e-19 42
soxS YP_002394058.1 DNA-binding transcriptional regulator SoxS BAC0560 Protein 1e-19 42
soxS YP_002394058.1 DNA-binding transcriptional regulator SoxS NC_002695.1.917339.p Protein 1e-19 42
soxS YP_002394058.1 DNA-binding transcriptional regulator SoxS CP000034.1.gene1596. Protein 1e-19 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
soxS YP_002394058.1 DNA-binding transcriptional regulator SoxS VFG0585 Protein 6e-46 96
soxS YP_002394058.1 DNA-binding transcriptional regulator SoxS VFG1038 Protein 4e-22 51