|
Name : alpA (ECIAI1_4501) Accession : YP_002389731.1 Strain : Escherichia coli IAI1 Genome accession: NC_011741 Putative virulence/resistance : Virulence Product : putative phage DNA binding protein Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 4580526 - 4580732 bp Length : 207 bp Strand : + Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type h : extrachromosomal origin DNA sequence : ATGAATACAACCAATCAAAGCTTAATTCGTTTACCAGAAGTCTTGAAACGAACTGGTTTCGGCAAAGCCTGGATCTATCG TCTGATCAGTGAAGGTCGGTTTCCGGCACCAGTGAAAATAGGTGTTCGTGCCGTTGCTTTTGTCGAGAGTGAAGTTGACG AGTGGATTCAATCAGTTATTGAAACAAGTCGAAATAATGTTGCTTAG Protein sequence : MNTTNQSLIRLPEVLKRTGFGKAWIYRLISEGRFPAPVKIGVRAVAFVESEVDEWIQSVIETSRNNVA |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| VPI2_0041 | ACA01856.1 | predicted transcriptional regulator | Not tested | VPI-2 | Protein | 1e-09 | 49 |
| unnamed | CAB46594.1 | DNA-binding protein | Not tested | HPI | Protein | 6e-06 | 48 |
| unnamed | CAA21398.1 | - | Not tested | HPI | Protein | 8e-06 | 48 |
| VC1809 | NP_231443.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-09 | 47 |
| VC0395_A1406 | YP_001217349.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-09 | 47 |
| VPI2_0033 | AAX20900.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 3e-07 | 46 |
| VC1785 | NP_231420.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 4e-07 | 46 |
| VC0395_A1382 | YP_001217325.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 4e-07 | 46 |
| VC0497 | NP_230151.1 | transcriptional regulator | Not tested | VSP-2 | Protein | 7e-06 | 45 |
| ORF SG104 | AAN62325.1 | phage-related protein | Not tested | PAGI-3(SG) | Protein | 7e-08 | 44 |
| Z1627 | NP_287131.1 | hypothetical protein | Not tested | TAI | Protein | 1e-05 | 43 |
| Z1188 | NP_286723.1 | hypothetical protein | Not tested | TAI | Protein | 1e-05 | 43 |
| PMI2608 | YP_002152324.1 | prophage regulatory protein | Not tested | Not named | Protein | 8e-05 | 42 |
| unnamed | CAD33739.1 | hypothetical protein | Not tested | PAI I 536 | Protein | 9e-08 | 42 |
| c5192 | NP_757040.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 1e-07 | 42 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| alpA | YP_002389731.1 | putative phage DNA binding protein | VFG1141 | Protein | 7e-10 | 47 |
| alpA | YP_002389731.1 | putative phage DNA binding protein | VFG1118 | Protein | 1e-07 | 46 |
| alpA | YP_002389731.1 | putative phage DNA binding protein | VFG1480 | Protein | 4e-08 | 42 |
