Gene Information

Name : soxS (EFER_4163)
Accession : YP_002385174.1
Strain : Escherichia fergusonii ATCC 35469
Genome accession: NC_011740
Putative virulence/resistance : Resistance
Product : DNA-binding transcriptional regulator SoxS
Function : -
COG functional category : K : Transcription
COG ID : COG2207
EC number : -
Position : 4267032 - 4267355 bp
Length : 324 bp
Strand : -
Note : regulates genes involved in response to oxidative stress

DNA sequence : 
ATGTCCCATCAGCAAATTATTCAGGCACTTATTGAATGGATTGATGAACATATCGACCAACCGCTGAACATTGATGTGGT
CGCTAAAAAATCGGGTTACTCGAAGTGGTATTTGCAGCGGATGTTCCGCACAGTGATGCACCAGACGCTGGGTGAATATA
TTCGCCAGCGCCGTCTTTTACTGGCCGCCGTTGAACTGCGCACGACTGAGCGCCCCATTTTTGATATTGCTATGGATCTG
GGCTACGTATCTCAGCAAACTTTCTCCCGCGTATTTCGCCGCGAATTTGATCGTACACCCAGCGATTATCGCCACCGCCT
GTAA

Protein sequence : 
MSHQQIIQALIEWIDEHIDQPLNIDVVAKKSGYSKWYLQRMFRTVMHQTLGEYIRQRRLLLAAVELRTTERPIFDIAMDL
GYVSQQTFSRVFRREFDRTPSDYRHRL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 6e-46 99
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 8e-21 49
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 8e-21 49

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
soxS YP_002385174.1 DNA-binding transcriptional regulator SoxS CP001138.1.gene4488. Protein 2e-46 99
soxS YP_002385174.1 DNA-binding transcriptional regulator SoxS NC_002695.1.914293.p Protein 2e-45 95
soxS YP_002385174.1 DNA-binding transcriptional regulator SoxS BAC0371 Protein 2e-45 95
soxS YP_002385174.1 DNA-binding transcriptional regulator SoxS CP001918.1.gene327.p Protein 1e-45 95
soxS YP_002385174.1 DNA-binding transcriptional regulator SoxS CP000034.1.gene4505. Protein 3e-45 94
soxS YP_002385174.1 DNA-binding transcriptional regulator SoxS CP000647.1.gene4499. Protein 8e-45 91
soxS YP_002385174.1 DNA-binding transcriptional regulator SoxS NC_010558.1.6276025. Protein 4e-21 49
soxS YP_002385174.1 DNA-binding transcriptional regulator SoxS CP001138.1.gene612.p Protein 5e-25 48
soxS YP_002385174.1 DNA-binding transcriptional regulator SoxS CP000647.1.gene1624. Protein 2e-19 42
soxS YP_002385174.1 DNA-binding transcriptional regulator SoxS CP001918.1.gene2033. Protein 8e-20 42
soxS YP_002385174.1 DNA-binding transcriptional regulator SoxS CP001138.1.gene1637. Protein 1e-19 41
soxS YP_002385174.1 DNA-binding transcriptional regulator SoxS BAC0560 Protein 1e-19 41
soxS YP_002385174.1 DNA-binding transcriptional regulator SoxS NC_002695.1.917339.p Protein 1e-19 41
soxS YP_002385174.1 DNA-binding transcriptional regulator SoxS CP000034.1.gene1596. Protein 1e-19 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
soxS YP_002385174.1 DNA-binding transcriptional regulator SoxS VFG0585 Protein 2e-46 99
soxS YP_002385174.1 DNA-binding transcriptional regulator SoxS VFG1038 Protein 3e-21 49