Gene Information

Name : PCC7424_4207 (PCC7424_4207)
Accession : YP_002379445.1
Strain : Cyanothece sp. PCC 7424
Genome accession: NC_011729
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4662720 - 4663463 bp
Length : 744 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: npu:Npun_F5788 two component transcriptional regulator

DNA sequence :
GTGGTAGAGACGTTGGAAACTCATAAGGAAAAAATTTTGGTAGTGGATGACGAAGCCAGCATTCGGCGTATTTTAGAAAC
CCGTCTTTCAATGATTGGCTATGATGTGGTTACTGCGGCTGACGGGGAAGAAGCCTTAGAAACGTTTCGTCAAACTAGCC
CAGATTTGGTGGTTTTAGACGTAATGATGCCAAAATTAGACGGCTACGGCGTTTGTCAGGAACTGAGAAAGGAATCTGAT
ATTCCTATTATTATGTTAACGGCTTTGGGAGATGTGGCCGATCGGATTACCGGCTTAGAACTCGGTGCAGATGACTATGT
GGTTAAACCCTTCTCTCCCAAAGAATTAGAAGCGAGAATTCGTTCAGTCCTCAGACGAGTTGAAAAAAATGGCGCTCCCG
GAATTCCCAGTTCTGGAGTGATTCATGTGGGGTCAATTAAAATTGATACGAACAAACGACAAGTCTATAAAGGAGATGAA
CGCATCCGCTTAACCGGCATGGAGTTTAGTCTATTGGAATTGTTAGTCAGTCGTTCAGGAGAACCCTTTTCCCGGTCAGA
AATTTTACAGGAAGTCTGGGGATATACCCCCGAACGCCACGTAGATACAAGGGTGGTAGATGTTCATATTTCCCGATTAA
GAGCAAAATTAGAAGATGATCCCAGTAATCCTGAACTTATTCTCACCGCTAGAGGTACAGGTTATCTTTTTCAACGCATT
TTAGAGCCAGGAGAAGAATTATAA

Protein sequence :
MVETLETHKEKILVVDDEASIRRILETRLSMIGYDVVTAADGEEALETFRQTSPDLVVLDVMMPKLDGYGVCQELRKESD
IPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRRVEKNGAPGIPSSGVIHVGSIKIDTNKRQVYKGDE
RIRLTGMEFSLLELLVSRSGEPFSRSEILQEVWGYTPERHVDTRVVDVHISRLRAKLEDDPSNPELILTARGTGYLFQRI
LEPGEEL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-30 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-30 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 5e-47 50
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 7e-47 50
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 7e-47 50
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 7e-47 50
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 7e-47 50
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 7e-47 50
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 7e-47 50
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 4e-47 50
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 7e-47 50
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 8e-47 49
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 4e-43 46
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-41 46
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator BAC0125 Protein 6e-39 45
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-44 45
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 7e-40 45
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 2e-25 43
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator BAC0083 Protein 2e-36 42
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 2e-40 42
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator BAC0638 Protein 2e-28 42
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-36 41
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-36 41
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-36 41
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-36 41
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-36 41
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-36 41
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-36 41
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-36 41
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 4e-38 41
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 2e-32 41
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 2e-29 41
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 5e-34 41
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 2e-28 41
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 1e-28 41
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator BAC0533 Protein 2e-29 41
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-33 41
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 2e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-39 44
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator VFG0596 Protein 6e-31 43
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator VFG1389 Protein 8e-34 43
PCC7424_4207 YP_002379445.1 winged helix family two component transcriptional regulator VFG1386 Protein 2e-36 41