Gene Information

Name : PCC7424_2242 (PCC7424_2242)
Accession : YP_002377532.1
Strain : Cyanothece sp. PCC 7424
Genome accession: NC_011729
Putative virulence/resistance : Resistance
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2497902 - 2498576 bp
Length : 675 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: amr:AM1_1480 two-component transcriptional regulator

DNA sequence :
ATGGCTGCTCATATTCTAGTTGTCGAAGATGAAGGGAAACTTGCTCAATTTATAGAATTAGAGCTAAAATACGAGGGATA
TCAGGTCACTGTTGCCCCAGATGGGTTAAGCGGATTAACAACAGCTAGAGAATCTAATCCAGACTTAATTTTACTCGATT
GGATGTTACCTGGAATCTCAGGGTTAGAAATTTGTAAGCGTCTACGACAAACGGGAAATAAAGTCCCCATTATTTTATTA
ACTGCTAAAGATGAAATTAGCGATCGCGTTACTGGATTAGATGCCGGAGCAGACGATTATATCATTAAACCGTTTAGCTT
AGAAGAATTATTAGCCAGAGTTAGGGCAAATTTACGACGCACATCGGAAAATAACGCAGATGAAGTGCAATTTATGGATT
TACGCCTTAACCGTAGTAGTCGAGAAGTTTATCGAGCTAACCGTTTAATTGAACTCACCGCTAAAGAATTTGATTTACTG
GAATATTTAATGTCTCATCCTCGCCAAGTTCTTACTAGAGAGCAAATATTAGAGCGGGTATGGGGTTATGATTTTATGGG
AGATTCTAATATAATCGAAGTTTATGTCCGCTATTTACGCTTAAAACTGGAGAATAACCAAGAAAAACGCTTAATTCAAA
CGGTTAGAGGCATTGGATATGTTTTACGGGAGTAG

Protein sequence :
MAAHILVVEDEGKLAQFIELELKYEGYQVTVAPDGLSGLTTARESNPDLILLDWMLPGISGLEICKRLRQTGNKVPIILL
TAKDEISDRVTGLDAGADDYIIKPFSLEELLARVRANLRRTSENNADEVQFMDLRLNRSSREVYRANRLIELTAKEFDLL
EYLMSHPRQVLTREQILERVWGYDFMGDSNIIEVYVRYLRLKLENNQEKRLIQTVRGIGYVLRE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-33 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-33 42
nisR2 YP_006309922.1 NisR Not tested FWisland_1 Protein 7e-24 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 2e-46 50
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 7e-49 49
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 7e-49 49
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 7e-49 49
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 7e-49 49
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 7e-49 49
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 7e-49 49
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 7e-49 49
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 7e-49 49
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 1e-44 48
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 3e-45 47
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 5e-45 47
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 5e-45 47
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 5e-45 47
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 4e-45 47
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 5e-45 47
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-45 47
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 5e-45 47
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 5e-45 47
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 5e-45 47
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 4e-41 46
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator BAC0111 Protein 8e-41 45
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator BAC0308 Protein 1e-40 45
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 5e-45 44
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator BAC0347 Protein 4e-38 44
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator BAC0083 Protein 3e-40 44
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 4e-37 43
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 1e-39 43
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator BAC0125 Protein 9e-42 43
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator BAC0197 Protein 6e-38 43
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator BAC0638 Protein 6e-34 43
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 1e-34 42
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 3e-42 42
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 6e-32 41
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 2e-28 41
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator Y16952.3.orf35.gene. Protein 1e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-55 54
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator VFG1386 Protein 2e-49 44
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator VFG1389 Protein 5e-43 44
PCC7424_2242 YP_002377532.1 winged helix family two component transcriptional regulator VFG0596 Protein 6e-34 43