
|
Name : Sbal223_0381 (Sbal223_0381) Accession : YP_002356338.1 Strain : Shewanella baltica OS223 Genome accession: NC_011663 Putative virulence/resistance : Virulence Product : phage transcriptional regulator AlpA Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 425948 - 426148 bp Length : 201 bp Strand : + Note : PFAM: Prophage CP4-57 regulatory; KEGG: spl:Spea_1260 phage transcriptional regulator, AlpA DNA sequence : ATGAAACTAATTAAACTAAAAGACGTTATCGCATCTACAGGCTTAGGGCGTTCGACCATTTACAAATATATTGAAAACGG TATATTTCCAAAAGCAGTATCACTTGGATGCCGTTCAGTTGCTTGGGTAGAGAGTGAAATACAAGATTGGATATTAGCGA GGATTGAAGAGCGGGACTTACAAAATGAAAAAGCTTGCTAA Protein sequence : MKLIKLKDVIASTGLGRSTIYKYIENGIFPKAVSLGCRSVAWVESEIQDWILARIEERDLQNEKAC |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| VC0497 | NP_230151.1 | transcriptional regulator | Not tested | VSP-2 | Protein | 8e-14 | 56 |
| VPI2_0033 | AAX20900.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 3e-11 | 51 |
| VC1785 | NP_231420.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 4e-11 | 51 |
| VC0395_A1382 | YP_001217325.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 4e-11 | 51 |
| VC1809 | NP_231443.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 6e-14 | 48 |
| VC0395_A1406 | YP_001217349.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 6e-14 | 48 |
| VPI2_0041 | ACA01856.1 | predicted transcriptional regulator | Not tested | VPI-2 | Protein | 7e-14 | 48 |
| PMI2608 | YP_002152324.1 | prophage regulatory protein | Not tested | Not named | Protein | 8e-09 | 47 |
| unnamed | CAB46594.1 | DNA-binding protein | Not tested | HPI | Protein | 2e-10 | 46 |
| unnamed | CAA21398.1 | - | Not tested | HPI | Protein | 2e-10 | 46 |
| unnamed | CAD33739.1 | hypothetical protein | Not tested | PAI I 536 | Protein | 1e-05 | 42 |
| c5192 | NP_757040.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 1e-05 | 42 |
| ORF SG104 | AAN62325.1 | phage-related protein | Not tested | PAGI-3(SG) | Protein | 3e-08 | 41 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| Sbal223_0381 | YP_002356338.1 | phage transcriptional regulator AlpA | VFG1118 | Protein | 1e-11 | 51 |
| Sbal223_0381 | YP_002356338.1 | phage transcriptional regulator AlpA | VFG1141 | Protein | 2e-14 | 48 |
| Sbal223_0381 | YP_002356338.1 | phage transcriptional regulator AlpA | VFG1480 | Protein | 4e-06 | 42 |