Gene Information

Name : Tmz1t_3985 (Tmz1t_3985)
Accession : YP_002890945.1
Strain : Thauera sp. MZ1T
Genome accession: NC_011662
Putative virulence/resistance : Virulence
Product : winged helix family two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4383286 - 4383966 bp
Length : 681 bp
Strand : +
Note : KEGG: azo:azo2946 two component response regulator; TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator; SMART: response regulator receiver

DNA sequence :
ATGAAAATTCTGATCGTCGAAGACGAAGTGAAGACCGGCGACTACCTCCGCCAGGGGCTCACCGAAGCCGGGTTCGTCGT
CGACCTTGCAAGAGATGGCCTCGATGGGCTCCACCTCGCACTCAATGGCGATTACGACCTCATCGTGCTGGATGTGATGC
TTCCGTCGCTGGACGGCTGGGGCATCCTGCAAACACTGCGGCGCGGCGGCCGTGAGACGCCTGTGCTGTTCCTCACTGCC
CGCGACCAAATTGAGGATCGCGTTCGTGGCCTTGAGCTCGGCGCCGATGATTACCTGGTCAAGCCCTTCGCGTTTTCCGA
GTTGCTCGCGCGCGTTCGCACGCTGCTGCGCAGGGGAAGAAACCACGAACCGGAGACCCTGCGCTCAGCGAACCTGGAGC
TCGATTTGCTTCGCCGCCGGGTGAACCGATGCGGGCAGCGCATCGATCTGACCGCCAAGGAGTTTGCCTTGCTGGAACTG
CTGCTGCGACGCAAGGGTGAAGTATTGCCCCGCTCACTCATCGCTTCGCAGGTGTGGGACATGAACTTCGACAGCGACAC
GAACGTGATCGAAGTTGCCGTGCGCAGGTTGCGCGTAAAGGTCGACGACCCCTTTGAGCCGAAGCTGATCCACACCGTGC
GGGGTATGGGCTACGTGCTTGAGGCGATGGAGCCGATCTGA

Protein sequence :
MKILIVEDEVKTGDYLRQGLTEAGFVVDLARDGLDGLHLALNGDYDLIVLDVMLPSLDGWGILQTLRRGGRETPVLFLTA
RDQIEDRVRGLELGADDYLVKPFAFSELLARVRTLLRRGRNHEPETLRSANLELDLLRRRVNRCGQRIDLTAKEFALLEL
LLRRKGEVLPRSLIASQVWDMNFDSDTNVIEVAVRRLRVKVDDPFEPKLIHTVRGMGYVLEAMEPI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-60 61
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-60 60

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tmz1t_3985 YP_002890945.1 winged helix family two component heavy metal response transcriptional regulator BAC0638 Protein 2e-67 71
Tmz1t_3985 YP_002890945.1 winged helix family two component heavy metal response transcriptional regulator BAC0083 Protein 1e-71 69
Tmz1t_3985 YP_002890945.1 winged helix family two component heavy metal response transcriptional regulator BAC0111 Protein 3e-73 68
Tmz1t_3985 YP_002890945.1 winged helix family two component heavy metal response transcriptional regulator BAC0197 Protein 8e-73 68
Tmz1t_3985 YP_002890945.1 winged helix family two component heavy metal response transcriptional regulator BAC0308 Protein 1e-70 67
Tmz1t_3985 YP_002890945.1 winged helix family two component heavy metal response transcriptional regulator BAC0125 Protein 3e-71 64
Tmz1t_3985 YP_002890945.1 winged helix family two component heavy metal response transcriptional regulator BAC0347 Protein 6e-67 61
Tmz1t_3985 YP_002890945.1 winged helix family two component heavy metal response transcriptional regulator HE999704.1.gene1528. Protein 8e-30 45
Tmz1t_3985 YP_002890945.1 winged helix family two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 5e-37 43
Tmz1t_3985 YP_002890945.1 winged helix family two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 5e-37 43
Tmz1t_3985 YP_002890945.1 winged helix family two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 5e-37 43
Tmz1t_3985 YP_002890945.1 winged helix family two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 5e-37 43
Tmz1t_3985 YP_002890945.1 winged helix family two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 5e-37 43
Tmz1t_3985 YP_002890945.1 winged helix family two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 5e-37 43
Tmz1t_3985 YP_002890945.1 winged helix family two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 5e-37 43
Tmz1t_3985 YP_002890945.1 winged helix family two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 5e-37 43
Tmz1t_3985 YP_002890945.1 winged helix family two component heavy metal response transcriptional regulator NC_002516.2.879194.p Protein 2e-29 41
Tmz1t_3985 YP_002890945.1 winged helix family two component heavy metal response transcriptional regulator NC_002952.2859905.p0 Protein 4e-32 41
Tmz1t_3985 YP_002890945.1 winged helix family two component heavy metal response transcriptional regulator NC_007622.3794472.p0 Protein 4e-32 41
Tmz1t_3985 YP_002890945.1 winged helix family two component heavy metal response transcriptional regulator U82965.2.orf14.gene. Protein 8e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tmz1t_3985 YP_002890945.1 winged helix family two component heavy metal response transcriptional regulator VFG0596 Protein 5e-61 61
Tmz1t_3985 YP_002890945.1 winged helix family two component heavy metal response transcriptional regulator VFG1390 Protein 5e-44 47
Tmz1t_3985 YP_002890945.1 winged helix family two component heavy metal response transcriptional regulator VFG1389 Protein 9e-36 45
Tmz1t_3985 YP_002890945.1 winged helix family two component heavy metal response transcriptional regulator VFG0473 Protein 1e-30 42
Tmz1t_3985 YP_002890945.1 winged helix family two component heavy metal response transcriptional regulator VFG1386 Protein 9e-37 42