Gene Information

Name : Tmz1t_1940 (Tmz1t_1940)
Accession : YP_002355587.1
Strain : Thauera sp. MZ1T
Genome accession: NC_011662
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2182192 - 2182851 bp
Length : 660 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: psa:PST_0906 DNA-binding response regulator

DNA sequence : 
ATGCGCATCCTGCTCGTCGAGGATGATGCCGCGCTCGGCGAGGGCATCCGCGTCGCGCTCAAGCCCGAGGCCTATACGGT
CGACTGGGTGCAGGACGGTGCGAGCGCGCTGCATGCGCTCACCCACGAGGACTTCGCGCTCGCCGTGCTCGACCTCGGCC
TGCCGCGCATGGATGGCCTGCAGGTGCTGCAGCGCCTGCGCGCCGCCGCCAACCCGGTGCCGGTGCTGGTGCTCACCGCG
CGCGACGCCACCAGCGACCGCATCGCGGGACTGGACGCGGGGGCGGACGACTACCTCGTCAAGCCCTTCGACGTCGACGA
GCTCAAGGCCCGCATCCGCGCGCTGCTGCGACGCAGCGCCAATCGTGCGCAGCCGGTGCTGCACCACGGCGAGGTCGTCC
TCGATCCGGTGAACCAGCAGGTCAGCTACCGCGGCCAGCCGGTGGTCCTGCAGCGCAAGGAGTTCCTGCTGCTGCACGAG
CTGCTCACCCAGCCCGGCCGCGTGCTGACCCGCGATCGGCTGCAGCAGGCCTTGTACGGCTGGGGCGAGGAGGCCGAGAG
CAATACGCTCGAGGTGCATATCCACCATCTGCGGCGCAAGCTGTTTCCCGAGCTGATCCGCACCGTGCGCGGCGTGGGCT
ATCTGGCGGACAAGGCCTGA

Protein sequence : 
MRILLVEDDAALGEGIRVALKPEAYTVDWVQDGASALHALTHEDFALAVLDLGLPRMDGLQVLQRLRAAANPVPVLVLTA
RDATSDRIAGLDAGADDYLVKPFDVDELKARIRALLRRSANRAQPVLHHGEVVLDPVNQQVSYRGQPVVLQRKEFLLLHE
LLTQPGRVLTRDRLQQALYGWGEEAESNTLEVHIHHLRRKLFPELIRTVRGVGYLADKA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 1e-39 48
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-33 45
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-33 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tmz1t_1940 YP_002355587.1 winged helix family two component transcriptional regulator BAC0487 Protein 9e-41 46
Tmz1t_1940 YP_002355587.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 8e-33 43
Tmz1t_1940 YP_002355587.1 winged helix family two component transcriptional regulator BAC0288 Protein 7e-35 42
Tmz1t_1940 YP_002355587.1 winged helix family two component transcriptional regulator BAC0197 Protein 1e-37 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tmz1t_1940 YP_002355587.1 winged helix family two component transcriptional regulator VFG0473 Protein 1e-44 49
Tmz1t_1940 YP_002355587.1 winged helix family two component transcriptional regulator VFG1390 Protein 5e-40 46
Tmz1t_1940 YP_002355587.1 winged helix family two component transcriptional regulator VFG0596 Protein 8e-34 45
Tmz1t_1940 YP_002355587.1 winged helix family two component transcriptional regulator VFG1389 Protein 8e-28 41