Gene Information

Name : Tmz1t_1913 (Tmz1t_1913)
Accession : YP_002355560.1
Strain : Thauera sp. MZ1T
Genome accession: NC_011662
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2158526 - 2159191 bp
Length : 666 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: tgr:Tgr7_0588 transcriptional regulator

DNA sequence : 
ATGCGCCTGCTCGTGGTCGAGGACGATGCGGCGCTCGGCGAGCGCCTGCGCACGCGGCTGGTCGCCGAAGGCTATGCGGT
GGACCTCGCGCGCGACGGCATCGACGGCGCCCATCTGGGCGCGACCGAGCCCTACGACGCGGTGATCCTCGACCTCGGCC
TGCCCGGCAAGCCGGGGCTGACCGTGCTGCGCGAGTGGCGCGCGGCGGCGAACCGCGTGCCGGTGCTGATCCTCACCGCG
CGCGACGGCTGGGCCGAGCGTGTCGAGGGCCTGCAGGCCGGCGCCGACGACTATCTCGGCAAGCCCTTCCATGTCGAGGA
GCTCCTCGCCCGCATCCAGGCCCTGCTGCGCCGCGCCGCGCCGGTGCCCGACACCGAGTTGCGCGCGGGCGACTGGCGGC
TGGACGAGGCGCGCCAGTGCCTGGTCGATCGCGCCGGCAACGAGCAGGCCCTGACCGCCACCGAGTTCCGCCTGCTGCGC
TACTTCATGCGCCACCCCGACGAGGTGCTGTCGAAGACGCGGCTCTCCGAGCACGTCTATGACTACGACGCCGAGCGCGA
CAGCAACGTCATCGAGGTCTACGTCCGCCGCCTGCGCGGCCTGCTCGGCAACGAACGCATCGAGACCCGGCGCGGGCAGG
GCTATGTGTTCCGCAGCGGCGACTGA

Protein sequence : 
MRLLVVEDDAALGERLRTRLVAEGYAVDLARDGIDGAHLGATEPYDAVILDLGLPGKPGLTVLREWRAAANRVPVLILTA
RDGWAERVEGLQAGADDYLGKPFHVEELLARIQALLRRAAPVPDTELRAGDWRLDEARQCLVDRAGNEQALTATEFRLLR
YFMRHPDEVLSKTRLSEHVYDYDAERDSNVIEVYVRRLRGLLGNERIETRRGQGYVFRSGD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-23 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-23 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tmz1t_1913 YP_002355560.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 1e-34 49
Tmz1t_1913 YP_002355560.1 winged helix family two component transcriptional regulator BAC0083 Protein 6e-27 44
Tmz1t_1913 YP_002355560.1 winged helix family two component transcriptional regulator BAC0111 Protein 5e-30 43
Tmz1t_1913 YP_002355560.1 winged helix family two component transcriptional regulator BAC0638 Protein 1e-20 43
Tmz1t_1913 YP_002355560.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-26 43
Tmz1t_1913 YP_002355560.1 winged helix family two component transcriptional regulator BAC0347 Protein 3e-26 42
Tmz1t_1913 YP_002355560.1 winged helix family two component transcriptional regulator BAC0125 Protein 3e-25 42
Tmz1t_1913 YP_002355560.1 winged helix family two component transcriptional regulator BAC0487 Protein 2e-25 41
Tmz1t_1913 YP_002355560.1 winged helix family two component transcriptional regulator CP000647.1.gene1136. Protein 3e-27 41
Tmz1t_1913 YP_002355560.1 winged helix family two component transcriptional regulator BAC0530 Protein 2e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tmz1t_1913 YP_002355560.1 winged helix family two component transcriptional regulator VFG1390 Protein 4e-28 46
Tmz1t_1913 YP_002355560.1 winged helix family two component transcriptional regulator VFG0596 Protein 4e-24 42