Gene Information

Name : Dtur_0537 (Dtur_0537)
Accession : YP_002352441.1
Strain : Dictyoglomus turgidum DSM 6724
Genome accession: NC_011661
Putative virulence/resistance : Resistance
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 537062 - 537736 bp
Length : 675 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: pca:Pcar_3081 two component signal transduction response regulator

DNA sequence :
ATGAAAATATTAATAATTGAGGATGAGAAAAAGTTAGGGACAGCTCTTAAGAAGGGATTAGAAAAAGAGGGTTATGTAGT
AGATTTAGCTTTTGATGGCGAAGAGGCAAAATATATTATAGAAAATAATTTTGAAGGTTATGATTTGGTAATATTGGACA
TTATGCTACCTAAAATAGATGGCATTTCTTTATGTAAAGATTTGAGAGCAAAAAATTTTCAAGCCCCTATATTAATGCTT
ACTGCCAAAGATAAAGTAGAGGATAAAATCTTAGGACTTGAAAGTGGGGCAGATGATTATTTAGTAAAACCTTTCTCTTA
TGAAGAATTGTTAGCTCGGATTAGAGCTCTTCTTAGAAGACCTAAGAATCTGATGCCTACAGTCTTAAAAGTAAAAGATA
TTTCCTTAGATACAGTTTCTAAAAGAGTTTTTAGGGGAGATATAGAGATCTTACTAACAAACAAAGAATTTGCTATCTTG
GAGTACCTTATGAGGAATGTGAATAGGATTATAAGTAAAGAACAAATTATATCTCATGTATGGGGCTACGAATCTGATAC
TCTTAGTAATGTAGTAGAAGCTCATATAAAGAATTTGAGAAAAAAATTAGAAAGGAAAAGGGATGAAAATATTATTGAGA
CCATTAGGGGAATGGGTTATCGGATTAAGGAGTAA

Protein sequence :
MKILIIEDEKKLGTALKKGLEKEGYVVDLAFDGEEAKYIIENNFEGYDLVILDIMLPKIDGISLCKDLRAKNFQAPILML
TAKDKVEDKILGLESGADDYLVKPFSYEELLARIRALLRRPKNLMPTVLKVKDISLDTVSKRVFRGDIEILLTNKEFAIL
EYLMRNVNRIISKEQIISHVWGYESDTLSNVVEAHIKNLRKKLERKRDENIIETIRGMGYRIKE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-27 43
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 6e-27 43
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-32 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 9e-32 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dtur_0537 YP_002352441.1 winged helix family two component transcriptional regulator BAC0083 Protein 2e-33 46
Dtur_0537 YP_002352441.1 winged helix family two component transcriptional regulator BAC0125 Protein 2e-39 45
Dtur_0537 YP_002352441.1 winged helix family two component transcriptional regulator BAC0197 Protein 3e-35 45
Dtur_0537 YP_002352441.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-27 44
Dtur_0537 YP_002352441.1 winged helix family two component transcriptional regulator BAC0111 Protein 4e-36 44
Dtur_0537 YP_002352441.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-34 44
Dtur_0537 YP_002352441.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-34 44
Dtur_0537 YP_002352441.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-34 44
Dtur_0537 YP_002352441.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-34 44
Dtur_0537 YP_002352441.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-34 44
Dtur_0537 YP_002352441.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-34 44
Dtur_0537 YP_002352441.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-34 44
Dtur_0537 YP_002352441.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-34 44
Dtur_0537 YP_002352441.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-34 44
Dtur_0537 YP_002352441.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-34 44
Dtur_0537 YP_002352441.1 winged helix family two component transcriptional regulator AF310956.2.orf0.gene Protein 4e-28 43
Dtur_0537 YP_002352441.1 winged helix family two component transcriptional regulator U35369.1.gene1.p01 Protein 2e-27 43
Dtur_0537 YP_002352441.1 winged helix family two component transcriptional regulator AE016830.1.gene2255. Protein 2e-27 43
Dtur_0537 YP_002352441.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-33 43
Dtur_0537 YP_002352441.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-33 43
Dtur_0537 YP_002352441.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-33 43
Dtur_0537 YP_002352441.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-33 43
Dtur_0537 YP_002352441.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-33 43
Dtur_0537 YP_002352441.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-33 43
Dtur_0537 YP_002352441.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-33 43
Dtur_0537 YP_002352441.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-33 43
Dtur_0537 YP_002352441.1 winged helix family two component transcriptional regulator BAC0487 Protein 3e-26 43
Dtur_0537 YP_002352441.1 winged helix family two component transcriptional regulator BAC0347 Protein 7e-32 43
Dtur_0537 YP_002352441.1 winged helix family two component transcriptional regulator BAC0288 Protein 8e-36 43
Dtur_0537 YP_002352441.1 winged helix family two component transcriptional regulator BAC0308 Protein 4e-33 43
Dtur_0537 YP_002352441.1 winged helix family two component transcriptional regulator BAC0638 Protein 7e-27 42
Dtur_0537 YP_002352441.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 4e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dtur_0537 YP_002352441.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-32 43
Dtur_0537 YP_002352441.1 winged helix family two component transcriptional regulator VFG1390 Protein 3e-37 42