Gene Information

Name : Dtur_1237 (Dtur_1237)
Accession : YP_002353129.1
Strain : Dictyoglomus turgidum DSM 6724
Genome accession: NC_011661
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1256169 - 1256867 bp
Length : 699 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: dth:DICTH_1122 response regulator DrrA

DNA sequence :
ATGAAAAAGATTCTTTTAGTAGAAGATGATAAAGGGATTGTAAATTCTTTGACTCTCTTACTTAACAAAGAGGGATACGA
GGTAGAAGTTGCATATGATGGGGTAGAGGCTTTAAACAAATTTAAACTATTCAATCCAGATCTTGTGCTTTTAGATATTA
TGTTGCCTGAAAAGGATGGCTGGGAGGTATGTAAGGAGATAAGAAAAATAAGTAATGTTCCTATCATTATGCTAACCGCG
AAAGACGAAGAAGTGGATAAAGTATTAGGATTAAAGATGGGAGCTGATGACTATATTACTAAACCTTTTGGTGCAAAAGA
ACTTTTGGCAAGGATAGAAGCAGTACTTAGAAGGTATCAATCAGATTTATCAAAAAGTCAAAAAATTGTGGCCCCTCCCT
TTGAGATGGACCTTGTGAAAAGGACAGTAAAAGTAAAAGGAAAAGAAGTTAATTTGTCCTATAGAGAGTTTGAGATTTTG
AAGCTTCTTCTTTCTTCTCCAGGGAGAGTGTGGACTAGAGATATGATAATAAAACACATATGGGGTGAGAACTTTTGGGG
TGAACCCAGAGCAGTAGATGTATATATAAGATGGTTGAGAGAAAAGGTAGAAGATGATCCAAGTCATCCTAAATATATTA
TTACTGTTAGGAACTTAGGATACAAATTCCAGGAGGGGAATGAAAATAAGCAAGATTGA

Protein sequence :
MKKILLVEDDKGIVNSLTLLLNKEGYEVEVAYDGVEALNKFKLFNPDLVLLDIMLPEKDGWEVCKEIRKISNVPIIMLTA
KDEEVDKVLGLKMGADDYITKPFGAKELLARIEAVLRRYQSDLSKSQKIVAPPFEMDLVKRTVKVKGKEVNLSYREFEIL
KLLLSSPGRVWTRDMIIKHIWGENFWGEPRAVDVYIRWLREKVEDDPSHPKYIITVRNLGYKFQEGNENKQD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dtur_1237 YP_002353129.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-48 49
Dtur_1237 YP_002353129.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-42 45
Dtur_1237 YP_002353129.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-42 45
Dtur_1237 YP_002353129.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-42 45
Dtur_1237 YP_002353129.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-42 45
Dtur_1237 YP_002353129.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-42 45
Dtur_1237 YP_002353129.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-42 45
Dtur_1237 YP_002353129.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-42 45
Dtur_1237 YP_002353129.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-42 45
Dtur_1237 YP_002353129.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-42 45
Dtur_1237 YP_002353129.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-42 45
Dtur_1237 YP_002353129.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 3e-29 44
Dtur_1237 YP_002353129.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 1e-36 44
Dtur_1237 YP_002353129.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-35 43
Dtur_1237 YP_002353129.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-35 43
Dtur_1237 YP_002353129.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-35 43
Dtur_1237 YP_002353129.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-35 43
Dtur_1237 YP_002353129.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-35 43
Dtur_1237 YP_002353129.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-35 43
Dtur_1237 YP_002353129.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-35 43
Dtur_1237 YP_002353129.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-35 43
Dtur_1237 YP_002353129.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-39 43
Dtur_1237 YP_002353129.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 5e-30 42
Dtur_1237 YP_002353129.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 7e-35 42
Dtur_1237 YP_002353129.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 1e-36 42
Dtur_1237 YP_002353129.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-35 42
Dtur_1237 YP_002353129.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 4e-37 41
Dtur_1237 YP_002353129.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 4e-37 41
Dtur_1237 YP_002353129.1 winged helix family two component transcriptional regulator BAC0125 Protein 1e-33 41
Dtur_1237 YP_002353129.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 5e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dtur_1237 YP_002353129.1 winged helix family two component transcriptional regulator VFG0596 Protein 1e-33 41
Dtur_1237 YP_002353129.1 winged helix family two component transcriptional regulator VFG1390 Protein 3e-37 41