
| Name : BCAH187_A0429 (BCAH187_A0429) Accession : YP_002336457.1 Strain : Bacillus cereus AH187 Genome accession: NC_011658 Putative virulence/resistance : Unknown Product : transposase Function : - COG functional category : - COG ID : - EC number : - Position : 393877 - 394140 bp Length : 264 bp Strand : - Note : an automated process has identified a potential problem with this gene model; the current end5 and/or the end3 may need to extended or the current gene model may need to be merged with a neighboring gene model; the current gene model (or a revised gene mo DNA sequence : ATGACGAAAAATAAAAGAGAAAGAAGAACATTTACAACAGAATTTAAACACCAAATGGTTCAACTGTATCAAAATGGTAA ACCAGGGAAAGACATCATTAAAGAATACAGATTAACACCATCATCATTGGATCGGTGGATCAATCAAAATCATACGTCTG GCTCGTTTAAAGAGAAAGATAATAAGACCGCTGAACAACTAGAATTGGAAGCTTTGAGAAAACAAAACAAAACAAACAGC TTCTTATGGAAAATGACATTTTAA Protein sequence : MTKNKRERRTFTTEFKHQMVQLYQNGKPGKDIIKEYRLTPSSLDRWINQNHTSGSFKEKDNKTAEQLELEALRKQNKTNS FLWKMTF | 
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity | 
| unnamed | BAC67553.1 | hypothetical protein | Not tested | Type-IVc SCCmec | Protein | 3e-16 | 56 | 
| SAR0081 | YP_039548.1 | transposase | Not tested | Type-II SCCmec | Protein | 5e-16 | 56 | 
| SACOL0464 | YP_185354.1 | IS3 family transposase | Not tested | vSa¥á | Protein | 2e-12 | 48 | 
| tnp | YP_001331418.1 | transposase | Not tested | vSa¥á | Protein | 2e-12 | 48 | 
| SAV0418 | NP_370942.1 | transposase | Not tested | vSa¥á | Protein | 1e-12 | 48 | 
| SA0379 | NP_373628.1 | transposase | Not tested | vSa¥á | Protein | 1e-12 | 48 | 
 
 
  