Gene Information

Name : E2348C_0238 (E2348C_0238)
Accession : YP_002327823.1
Strain : Escherichia coli E2348/69
Genome accession: NC_011601
Putative virulence/resistance : Unknown
Product : transposase Orf1 of IS3 family IS element
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 270037 - 270375 bp
Length : 339 bp
Strand : +
Note : -

DNA sequence :
GTGATATGCTCACCTCAGAACAACACAGGTGCTCCAATGAAAAAAAGAAATTTCAGCGCAGAGTTTAAACGCGAATCCGC
TCAACTGGTTGTTGACCAGAACTACACGGTGGCAGATGCCGCCAAAGCTATGGATATCGGCCTTTTCACAATGACAAGAT
GGGTCAAACAACTGCGTGATGAGCGTCAGGGCAAAACACCAAAAGCCTCTCCGATAACACCAGAACAAATCGAAATACGT
GAGCTGAGGAAAAAGCTACAACGCATTGAAATGGAGAATGAAATATTAAAAAAGGCTACCGCGCTCTTGATGTCAGACTC
CCTGAACAGTTCTCGATAA

Protein sequence :
MICSPQNNTGAPMKKRNFSAEFKRESAQLVVDQNYTVADAAKAMDIGLFTMTRWVKQLRDERQGKTPKASPITPEQIEIR
ELRKKLQRIEMENEILKKATALLMSDSLNSSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
l7045 CAD33744.1 - Not tested PAI I 536 Protein 1e-40 99
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 1e-40 99
api80 CAF28554.1 putative transposase Not tested YAPI Protein 3e-34 94
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 6e-39 92
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-33 72
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-33 72
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-33 72
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-33 72
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-33 72
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-33 72
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-33 72
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-33 72
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 4e-29 71
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 3e-25 59
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 2e-25 59
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 4e-22 59
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 2e-24 57
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 2e-24 57
unnamed AAC31483.1 L0004 Not tested LEE Protein 2e-24 57
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 5e-22 54
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 1e-19 46
tnpA CAB61575.1 transposase A Not tested HPI Protein 4e-19 45
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 2e-11 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
E2348C_0238 YP_002327823.1 transposase Orf1 of IS3 family IS element VFG1485 Protein 5e-41 99
E2348C_0238 YP_002327823.1 transposase Orf1 of IS3 family IS element VFG1123 Protein 7e-34 72
E2348C_0238 YP_002327823.1 transposase Orf1 of IS3 family IS element VFG1553 Protein 2e-29 71
E2348C_0238 YP_002327823.1 transposase Orf1 of IS3 family IS element VFG0784 Protein 6e-25 57
E2348C_0238 YP_002327823.1 transposase Orf1 of IS3 family IS element VFG1566 Protein 6e-12 42