Gene Information

Name : ABBFA_001145 (ABBFA_001145)
Accession : YP_002325052.1
Strain : Acinetobacter baumannii AB307-0294
Genome accession: NC_011595
Putative virulence/resistance : Resistance
Product : Quaternary ammonium compound-resistance protein qacE (Quaternaryammonium determinant E)
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2076
EC number : -
Position : 1249019 - 1249348 bp
Length : 330 bp
Strand : -
Note : [P] COG2076 Membrane transporters of cations and cationic drugs

DNA sequence :
ATGTCTTATCTTTATTTAGCAATTGCGATTGCTTGTGAAGTTATTGCAACTTCAGCATTAAAAGCATCTCAAGGTTTTAC
TGTTCCAATTCCGTCTATTATTACAGTTGTGGGTTATGCAGTTGCTTTTTATTTATTATCTCTTACGCTCAAAACAATTC
CAATCGGGATTGCCTATGCCATTTGGTCAGGCGCAGGTATTATTTTAATTTCTGCAATTGGCTGGATATTTTACAAACAA
CATTTAGACTTAGCTGCCTGCATTGGTTTAGCTTTAATGATCGCAGGCATTGTGATTATTAATGTGTTTTCTAAAAACAC
CCATCTATAA

Protein sequence :
MSYLYLAIAIACEVIATSALKASQGFTVPIPSIITVVGYAVAFYLLSLTLKTIPIGIAYAIWSGAGIILISAIGWIFYKQ
HLDLAACIGLALMIAGIVIINVFSKNTHL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 3e-14 54
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 3e-14 54
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 3e-14 54
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 3e-14 54
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 3e-14 54
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 3e-14 54
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 3e-14 54
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 3e-14 54
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 3e-14 54
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 3e-14 54
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 5e-14 54
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 3e-14 54
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 3e-14 54
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 3e-14 54
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 5e-14 54
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 3e-14 54
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 3e-14 54
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-14 54
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 5e-14 54
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 3e-14 54
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 3e-14 54
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-14 54
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 5e-14 54
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 3e-14 54
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 3e-14 54
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-14 54
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 5e-14 54
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 3e-14 54
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 3e-14 54
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-14 54
unnamed CAD42068.1 hypothetical protein Not tested PAI II 536 Protein 9e-08 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ABBFA_001145 YP_002325052.1 Quaternary ammonium compound-resistance protein qacE (Quaternaryammonium determinant E) BAC0002 Protein 2e-35 100
ABBFA_001145 YP_002325052.1 Quaternary ammonium compound-resistance protein qacE (Quaternaryammonium determinant E) NC_010410.6003348.p0 Protein 2e-35 100
ABBFA_001145 YP_002325052.1 Quaternary ammonium compound-resistance protein qacE (Quaternaryammonium determinant E) BAC0324 Protein 1e-17 55
ABBFA_001145 YP_002325052.1 Quaternary ammonium compound-resistance protein qacE (Quaternaryammonium determinant E) CP004022.1.gene1549. Protein 5e-14 54
ABBFA_001145 YP_002325052.1 Quaternary ammonium compound-resistance protein qacE (Quaternaryammonium determinant E) BAC0323 Protein 1e-14 54
ABBFA_001145 YP_002325052.1 Quaternary ammonium compound-resistance protein qacE (Quaternaryammonium determinant E) BAC0150 Protein 1e-12 53
ABBFA_001145 YP_002325052.1 Quaternary ammonium compound-resistance protein qacE (Quaternaryammonium determinant E) NC_002695.1.913273.p Protein 1e-12 52
ABBFA_001145 YP_002325052.1 Quaternary ammonium compound-resistance protein qacE (Quaternaryammonium determinant E) CP001138.1.gene1489. Protein 4e-13 52
ABBFA_001145 YP_002325052.1 Quaternary ammonium compound-resistance protein qacE (Quaternaryammonium determinant E) BAC0322 Protein 2e-17 51
ABBFA_001145 YP_002325052.1 Quaternary ammonium compound-resistance protein qacE (Quaternaryammonium determinant E) BAC0377 Protein 4e-17 51
ABBFA_001145 YP_002325052.1 Quaternary ammonium compound-resistance protein qacE (Quaternaryammonium determinant E) BAC0325 Protein 4e-10 44
ABBFA_001145 YP_002325052.1 Quaternary ammonium compound-resistance protein qacE (Quaternaryammonium determinant E) BAC0139 Protein 1e-13 44
ABBFA_001145 YP_002325052.1 Quaternary ammonium compound-resistance protein qacE (Quaternaryammonium determinant E) BAC0140 Protein 4e-09 43
ABBFA_001145 YP_002325052.1 Quaternary ammonium compound-resistance protein qacE (Quaternaryammonium determinant E) BAC0329 Protein 3e-10 41
ABBFA_001145 YP_002325052.1 Quaternary ammonium compound-resistance protein qacE (Quaternaryammonium determinant E) BAC0192 Protein 1e-12 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ABBFA_001145 YP_002325052.1 Quaternary ammonium compound-resistance protein qacE (Quaternaryammonium determinant E) VFG1587 Protein 4e-08 45