Gene Information

Name : tetA (AB57_0275)
Accession : YP_002317684.1
Strain : Acinetobacter baumannii AB0057
Genome accession: NC_011586
Putative virulence/resistance : Resistance
Product : tetracycline resistance protein, class A
Function : -
COG functional category : G : Carbohydrate transport and metabolism
COG ID : COG2814
EC number : -
Position : 292216 - 293343 bp
Length : 1128 bp
Strand : +
Note : -

DNA sequence :
ATGCCGGTGCTGCCGGGCCTCCTGCGCGATCTGGTTCACTCGAACGACGTCACCGCCCACTATGGCATTCTGCTGGCGCT
GTATGCGTTGATGCAATTTGCCTGCGCACCTGTGCTGGGCGCGCTGTCGGATCGTTTCGGGCGGCGGCCGGTCTTGCTCG
TCTCGCTGGCCGGCGCTGCTGTCGACTACGCCATCATGGCGACGGCGCCTTTCCTTTGGGTTCTCTATATCGGGCGGATC
GTGGCCGGCATCACCGGGGCGACTGGGGCGGTAGCCGGCGCTTATATTGCCGATATCACTGATGGCGATGAGCGCGCGCG
GCACTTCGGCTTCATGAGCGCCTGTTTCGGGTTCGGGATGGTCGCGGGACCTGTGCTCGGTGGGCTGATGGGCGGTTTCT
CCCCCCACGCTCCGTTCTTCGCCGCGGCAGCCTTGAACGGCCTCAATTTCCTGACGGGCTGTTTCCTTTTGCCGGAGTCG
CACAAAGGCGAACGCCGGCCGTTACGCCGGGAGGCTCTCAACCCGCTCGCTTCGTTCCGGTGGGCCCGGGGCATGACCGT
CGTCGCCGCCCTGATGGCGGTCTTCTTCATCATGCAACTTGTCGGACAGGTGCCGGCCGCGCTTTGGGTCATTTTCGGCG
AGGATCGCTTTCACTGGGACGCGACCACGATCGGCATTTCGCTTGCCGCATTTGGCATTCTGCATTCACTCGCCCAGGCA
ATGATCACCGGCCCTGTAGCCGCCCGGCTCGGCGAAAGGCGGGCACTCATGCTCGGAATGATTGCCGACGGCACAGGCTA
CATCCTGCTTGCCTTCGCGACACGGGGATGGATGGCGTTCCCGATCATGGTCCTGCTTGCTTCGGGTGGCATCGGAATGC
CGGCGCTGCAAGCAATGTTGTCCAGGCAGGTGGATGAGGAACGTCAGGGGCAGCTGCAAGGCTCACTGGCGGCGCTCACC
AGCCTGACCTCGATCGTCGGACCCCTCCTCTTCACGGCGATCTATGCGGCTTCTATAACAACGTGGAACGGGTGGGCATG
GATTGCAGGCGCTGCCCTCTACTTGCTCTGCCTGCCGGCGCTGCGTCGCGGGCTTTGGAGCGGCGCAGGGCAACGAGCCG
ATCGCTGA

Protein sequence :
MPVLPGLLRDLVHSNDVTAHYGILLALYALMQFACAPVLGALSDRFGRRPVLLVSLAGAAVDYAIMATAPFLWVLYIGRI
VAGITGATGAVAGAYIADITDGDERARHFGFMSACFGFGMVAGPVLGGLMGGFSPHAPFFAAAALNGLNFLTGCFLLPES
HKGERRPLRREALNPLASFRWARGMTVVAALMAVFFIMQLVGQVPAALWVIFGEDRFHWDATTIGISLAAFGILHSLAQA
MITGPVAARLGERRALMLGMIADGTGYILLAFATRGWMAFPIMVLLASGGIGMPALQAMLSRQVDEERQGQLQGSLAALT
SLTSIVGPLLFTAIYAASITTWNGWAWIAGAALYLLCLPALRRGLWSGAGQRADR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tetA YP_006098396.1 tetracycline resistance protein Not tested Tn2411 Protein 1e-150 100
tetA(A) ACK44537.1 TetA(A) Not tested SGI1 Protein 1e-150 100
tetA(A) AGK07027.1 TetA(A) Not tested SGI1 Protein 1e-150 100
tetA(A) AGK07085.1 TetA(A) Not tested SGI1 Protein 1e-150 100
tetA(A) ACN81011.1 TetA(A) Not tested AbaR5 Protein 3e-151 100
tetA CAJ77066.1 Tetracycline resistance protein Not tested AbaR1 Protein 2e-151 100
tetA(G) ABZ01843.1 TetA(G) Not tested SGI2 Protein 2e-98 63
tetA(G) AGK06974.1 TetA(G) Not tested SGI1 Protein 2e-98 63
tetA(G) AGK07104.1 TetA(G) Not tested SGI1 Protein 2e-98 63
tet(G) AAK02051.1 tetracycline resistance protein Not tested SGI1 Protein 2e-98 63
tetA CAJ77034.1 Tetracycline resistance protein Not tested AbaR1 Protein 8e-99 63
tetA YP_005797160.1 tetracycline resistance protein, class G (TETA(G)) Not tested AbaR4e Protein 2e-70 48
tetA(B) AEZ06045.1 tetracycline efflux protein Not tested Tn6167 Protein 1e-70 48
tetB AEA34667.1 tetracycline resistance determinant Not tested Not named Protein 9e-71 48
tetA(B) AAL08445.1 tetracycline resistance protein TetA(B) Not tested SRL Protein 8e-71 48
tetA(B) AEQ20905.1 tetracycline resistance protein Not tested Tn6166 Protein 2e-70 48
BJAB07104_00277 YP_008207742.1 Permeases of the major facilitator superfamily Not tested AbaR25 Protein 2e-70 48
BJAB0868_00281 YP_008211607.1 Permeases of the major facilitator superfamily Not tested AbaR26 Protein 2e-70 48
ABZJ_00260 YP_005524216.1 Tetracycline resistance protein, class B (TETA(B) ) (Metal-tetracycline/H(+) antiporter) Not tested AbaR22 Protein 2e-70 48
tetA(B) AFH57202.1 tetracycline resistance protein Not tested AbaR4a Protein 1e-70 48
tet(H) YP_005176248.1 tetracycline efflux protein, class H Not tested ICEPmu1 Protein 3e-64 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
tetA YP_002317684.1 tetracycline resistance protein, class A NC_011586.7045189.p0 Protein 5e-150 100
tetA YP_002317684.1 tetracycline resistance protein, class A NC_010410.6002597.p0 Protein 1e-151 100
tetA YP_002317684.1 tetracycline resistance protein, class A CP001485.1.gene2821. Protein 1e-151 100
tetA YP_002317684.1 tetracycline resistance protein, class A X75761.gene.p01 Protein 2e-150 99
tetA YP_002317684.1 tetracycline resistance protein, class A AF534183.gene.p01 Protein 3e-148 99
tetA YP_002317684.1 tetracycline resistance protein, class A Y19114.gene.p01 Protein 7e-120 80
tetA YP_002317684.1 tetracycline resistance protein, class A NC_010410.6002612.p0 Protein 5e-99 63
tetA YP_002317684.1 tetracycline resistance protein, class A AF133140.gene.p01 Protein 5e-99 63
tetA YP_002317684.1 tetracycline resistance protein, class A AF133139.gene.p01 Protein 1e-100 63
tetA YP_002317684.1 tetracycline resistance protein, class A AF070999.gene.p01 Protein 3e-82 54
tetA YP_002317684.1 tetracycline resistance protein, class A Y19116.gene.p01 Protein 3e-74 54
tetA YP_002317684.1 tetracycline resistance protein, class A L06940.gene.p01 Protein 9e-75 54
tetA YP_002317684.1 tetracycline resistance protein, class A AY264780.2.gene3.p01 Protein 3e-74 53
tetA YP_002317684.1 tetracycline resistance protein, class A AY743590.gene.p01 Protein 8e-67 49
tetA YP_002317684.1 tetracycline resistance protein, class A L06798.gene.p01 Protein 1e-63 49
tetA YP_002317684.1 tetracycline resistance protein, class A AF121000.gene.p01 Protein 4e-66 48
tetA YP_002317684.1 tetracycline resistance protein, class A AJ420072.gene.p01 Protein 2e-63 48
tetA YP_002317684.1 tetracycline resistance protein, class A AB084246.gene.p01 Protein 8e-71 48
tetA YP_002317684.1 tetracycline resistance protein, class A V00611.gene.p01 Protein 1e-70 48
tetA YP_002317684.1 tetracycline resistance protein, class A NC_010558.1.6275971. Protein 5e-71 48
tetA YP_002317684.1 tetracycline resistance protein, class A AF038993.gene.p01 Protein 4e-64 48
tetA YP_002317684.1 tetracycline resistance protein, class A CP004022.1.gene2534. Protein 1e-63 48
tetA YP_002317684.1 tetracycline resistance protein, class A Y15510.gene.p01 Protein 5e-65 47
tetA YP_002317684.1 tetracycline resistance protein, class A AF090987.gene.p01 Protein 4e-57 45
tetA YP_002317684.1 tetracycline resistance protein, class A AJ250203.gene.p01 Protein 6e-60 43
tetA YP_002317684.1 tetracycline resistance protein, class A NC_009085.4918440.p0 Protein 2e-48 42
tetA YP_002317684.1 tetracycline resistance protein, class A NC_011586.7043399.p0 Protein 6e-50 42
tetA YP_002317684.1 tetracycline resistance protein, class A NC_011595.7059241.p0 Protein 7e-50 42
tetA YP_002317684.1 tetracycline resistance protein, class A NC_010410.6003291.p0 Protein 8e-50 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
tetA YP_002317684.1 tetracycline resistance protein, class A VFG1036 Protein 5e-71 48