Gene Information

Name : swp_4501 (swp_4501)
Accession : YP_002313731.1
Strain : Shewanella piezotolerans WP3
Genome accession: NC_011566
Putative virulence/resistance : Unknown
Product : ISSwp4, transposase OrfA
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 4719419 - 4719727 bp
Length : 309 bp
Strand : -
Note : -

DNA sequence :
ATGACGAAACGTACAAGAAGACTTTTTAGCGCAGAATTCAAACTTGAATCAGCTCAATTAGTGCTAGATCAAAATTACTC
AATTGTTGAAGCCGCTCAAGCTATGAACGTGGGTAAATCGACCATGGATAAGTGGGTTCGGCAATTAAGAGAAGAGCGAC
AAGGTAAGCAACCTAAAGCATCACCTATATCACCAGAACAAATTGAAATTCGAGAGTTAAAAAAGCAACTAGCTCGCCTC
CAGGAGCACAACGAAATATTAAAAAAAGCCACAGCTCTGTTGATGTCGGACTCACTGAACAATTCTTAA

Protein sequence :
MTKRTRRLFSAEFKLESAQLVLDQNYSIVEAAQAMNVGKSTMDKWVRQLREERQGKQPKASPISPEQIEIRELKKQLARL
QEHNEILKKATALLMSDSLNNS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-40 93
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 4e-40 93
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-40 93
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-40 93
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-40 93
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-40 93
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-40 93
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 4e-40 93
l7045 CAD33744.1 - Not tested PAI I 536 Protein 3e-30 74
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 3e-30 74
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 8e-30 74
api80 CAF28554.1 putative transposase Not tested YAPI Protein 8e-26 71
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 8e-28 64
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 1e-24 64
unnamed AAC31483.1 L0004 Not tested LEE Protein 6e-28 64
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 9e-28 64
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 9e-28 64
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 2e-28 63
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 3e-28 63
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 7e-21 52
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 2e-18 48
tnpA CAB61575.1 transposase A Not tested HPI Protein 6e-18 47
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 2e-13 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
swp_4501 YP_002313731.1 ISSwp4, transposase OrfA VFG1123 Protein 1e-40 93
swp_4501 YP_002313731.1 ISSwp4, transposase OrfA VFG1485 Protein 1e-30 74
swp_4501 YP_002313731.1 ISSwp4, transposase OrfA VFG1553 Protein 5e-25 64
swp_4501 YP_002313731.1 ISSwp4, transposase OrfA VFG0784 Protein 3e-28 64
swp_4501 YP_002313731.1 ISSwp4, transposase OrfA VFG1566 Protein 9e-14 43