Gene Information

Name : RC1_0686 (RC1_0686)
Accession : YP_002296934.1
Strain : Rhodospirillum centenum SW
Genome accession: NC_011420
Putative virulence/resistance : Virulence
Product : two-component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 735778 - 736455 bp
Length : 678 bp
Strand : +
Note : -

DNA sequence : 
ATGAAGATCCTGGTGATCGAAGACGACGCCGGCACGGCGGAGTACCTGACCAAGGGCCTGAAGGAGGCCGGCCACGTCGT
CGATCATGCGGCGACGGGGAAGGACGGTCTGTTCCTGGCGGCGAGCGAGAGTTACGACGCGCTGGTGGTGGACAGGATGC
TGCCCGGGCGCGACGGGCTGTCGGTGCTGGAGGTCTTGCGTGCCACCGGGAACGGCATTCCGGCTCTGGTCCTGAGTGCC
CTGTCCAGCGTGGAGGACCGCGTGAAGGGCCTGCGTGCCGGCGCGGACGACTATCTTCCCAAGCCTTTCGCCTTCTCCGA
ACTGCTCGCGCGCCTGGACGCGCTGGAGCGGCGTGCCCGCGGCAGCGGGCCGGTGACGCGCCTGCAGGTGTCCGACCTGG
AGATGGATCTGCTGGCGCGCAGCGTCTCGCGTGCCGGGCGGCCGGTCGATCTGCTGCCGCGGGAATTCCTGCTGCTGGAG
TTCCTGATGCGCAACGCCGGCCATGTCGTGACCCGCACCATGCTGCTGGAGCGGGTCTGGGACTATCACTTCGACCCCCA
GACGAACGTCATCGACGTCCATATCGCGCGGTTGCGCCAGAAGATCGACAAGGACCACCCGGCACCGCTGATTCATACGG
TGCGCGGGGCGGGCTACGTGCTCCGTGCTCCGGGCTAA

Protein sequence : 
MKILVIEDDAGTAEYLTKGLKEAGHVVDHAATGKDGLFLAASESYDALVVDRMLPGRDGLSVLEVLRATGNGIPALVLSA
LSSVEDRVKGLRAGADDYLPKPFAFSELLARLDALERRARGSGPVTRLQVSDLEMDLLARSVSRAGRPVDLLPREFLLLE
FLMRNAGHVVTRTMLLERVWDYHFDPQTNVIDVHIARLRQKIDKDHPAPLIHTVRGAGYVLRAPG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-35 52
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 9e-35 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RC1_0686 YP_002296934.1 two-component transcriptional regulator BAC0638 Protein 5e-40 52
RC1_0686 YP_002296934.1 two-component transcriptional regulator BAC0347 Protein 1e-40 51
RC1_0686 YP_002296934.1 two-component transcriptional regulator BAC0083 Protein 3e-40 51
RC1_0686 YP_002296934.1 two-component transcriptional regulator BAC0111 Protein 4e-43 50
RC1_0686 YP_002296934.1 two-component transcriptional regulator BAC0125 Protein 1e-40 50
RC1_0686 YP_002296934.1 two-component transcriptional regulator BAC0197 Protein 1e-36 48
RC1_0686 YP_002296934.1 two-component transcriptional regulator BAC0308 Protein 5e-34 46
RC1_0686 YP_002296934.1 two-component transcriptional regulator BAC0487 Protein 7e-22 43
RC1_0686 YP_002296934.1 two-component transcriptional regulator HE999704.1.gene1528. Protein 1e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RC1_0686 YP_002296934.1 two-component transcriptional regulator VFG0596 Protein 9e-36 52
RC1_0686 YP_002296934.1 two-component transcriptional regulator VFG1390 Protein 1e-31 47
RC1_0686 YP_002296934.1 two-component transcriptional regulator VFG1389 Protein 4e-25 45
RC1_0686 YP_002296934.1 two-component transcriptional regulator VFG1386 Protein 8e-27 42