
|
Name : cueR (RC1_0141) Accession : YP_002296403.1 Strain : Rhodospirillum centenum SW Genome accession: NC_011420 Putative virulence/resistance : Resistance Product : HTH-type transcriptional regulator cueR Function : - COG functional category : K : Transcription COG ID : COG0789 EC number : - Position : 130346 - 130780 bp Length : 435 bp Strand : - Note : Alternate namesMatched to PF00376: transcriptional regulator, MerR family; identified by match to protein family HMM PF00551 match to protein family HMM PF01842 match to protein family HMM TIGR00655 DNA sequence : ATGAACATCGGCCGTCTGGGCAGCCTCACGGAGACGAATGTCGAGACGATCCGCTACTACGAGCGGATCGGGCTCTTGCC GCCGCCGCCGCGGACGCAGAGCAACTACCGTGACTATGACGACGGGCATGTGCGGCGGCTGTCCTTCATCCGGCGGGCAC GCGCCCTCGGCTTCCATCTGGACACGATCCGGGCGCTGCTGGACGTGTCGGACCGGCCGGACCAGTCCTGCGCCGGCGTG GACGCGCTGACCCGCCGGCAGATCGCCGAGGTGGAGGCGAAAATCGCCGACCTGACCCGGCTACGCGACGAGCTGGTCCG TCTCGCCGGCCAGTGCCGCGGCGACCGGATCAGGGACTGCCGCATCATCGAAGCCCTGTCGCCGCCGGTCCTACCGGAAC CCCTGCCAGAAATGCCCGCCCAGGGCCGGCCGTGA Protein sequence : MNIGRLGSLTETNVETIRYYERIGLLPPPPRTQSNYRDYDDGHVRRLSFIRRARALGFHLDTIRALLDVSDRPDQSCAGV DALTRRQIAEVEAKIADLTRLRDELVRLAGQCRGDRIRDCRIIEALSPPVLPEPLPEMPAQGRP |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| ORF C98 | AAN62191.1 | putative transcriptional regulator | Not tested | PAGI-2(C) | Protein | 5e-22 | 48 |
| ACICU_00234 | YP_001844893.1 | transcriptional regulator | Not tested | AbaR20 | Protein | 5e-21 | 46 |
| cadR | ACS32041.1 | MerR family transcriptional regulator | Not tested | AbaR5 | Protein | 5e-21 | 46 |
| cadR | ADZ05769.1 | MerR family transcriptional regulator | Not tested | AbaR11 | Protein | 3e-21 | 46 |
| cadR | ACN81029.1 | MerR family transcriptional regulator | Not tested | AbaR5 | Protein | 5e-21 | 46 |
| pbrR | CAJ77094.1 | Transcriptional regulator | Not tested | AbaR1 | Protein | 4e-21 | 46 |
| cadR | AGK36653.1 | MerR family transcriptional regulator | Not tested | AbaR26 | Protein | 4e-21 | 46 |
| pbrR | CAJ77021.1 | transcription regulator | Not tested | AbaR1 | Protein | 4e-21 | 46 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| cueR | YP_002296403.1 | HTH-type transcriptional regulator cueR | BAC0058 | Protein | 1e-25 | 51 |
| cueR | YP_002296403.1 | HTH-type transcriptional regulator cueR | BAC0682 | Protein | 7e-19 | 45 |
| cueR | YP_002296403.1 | HTH-type transcriptional regulator cueR | BAC0190 | Protein | 6e-19 | 42 |