Gene Information

Name : ECSE_4580 (ECSE_4580)
Accession : YP_002295855.1
Strain : Escherichia coli SE11
Genome accession: NC_011415
Putative virulence/resistance : Unknown
Product : transposase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 4785412 - 4785744 bp
Length : 333 bp
Strand : +
Note : -

DNA sequence :
ATGTTCACCTCAGAACAACACAGGTGCTCCAATGAAAAAAGAAATTTTAGCGCAGAGTTTAAACGCGAATCAGCTCAACT
GGTTGTTGACCAGAACTACACGGTGGCAGATGCCGCCAAAGCTATGGATGTCGGCCTTTCAACAATGACAAGATGGGTCA
AACAACAGCGTGATGAGCATCAGGGCAAAACACCAAAAGCCTCTCCGATGACACCAGAACAAATCGAAATACGTGAGCTG
AGGAAAAAGCTACAACGCATTGAAATGGAGAATGAAATATTAAAAAAGGCTACAGCGCTCTTGATGTCAGACTCCCTGAA
CAGTTCTCGATAA

Protein sequence :
MFTSEQHRCSNEKRNFSAEFKRESAQLVVDQNYTVADAAKAMDVGLSTMTRWVKQQRDEHQGKTPKASPMTPEQIEIREL
RKKLQRIEMENEILKKATALLMSDSLNSSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
l7045 CAD33744.1 - Not tested PAI I 536 Protein 1e-38 96
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 1e-38 96
api80 CAF28554.1 putative transposase Not tested YAPI Protein 2e-32 92
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 5e-37 91
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-30 77
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-30 77
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-30 77
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-30 77
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-30 77
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-30 77
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-30 77
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-30 77
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 8e-29 71
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 1e-22 59
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 1e-22 59
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 3e-21 57
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 5e-22 55
unnamed AAC31483.1 L0004 Not tested LEE Protein 1e-21 52
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 1e-21 52
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 1e-21 52
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 2e-18 47
tnpA CAB61575.1 transposase A Not tested HPI Protein 5e-18 45

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECSE_4580 YP_002295855.1 transposase VFG1485 Protein 4e-39 96
ECSE_4580 YP_002295855.1 transposase VFG1123 Protein 4e-31 77
ECSE_4580 YP_002295855.1 transposase VFG1553 Protein 3e-29 71
ECSE_4580 YP_002295855.1 transposase VFG0784 Protein 4e-22 52