Gene Information

Name : OCAR_7752 (OCAR_7752)
Accession : YP_002290713.1
Strain : Oligotropha carboxidovorans OM5; ATCC 49405
Genome accession: NC_011386
Putative virulence/resistance : Resistance
Product : mercuric transport periplasmic protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 3717874 - 3718161 bp
Length : 288 bp
Strand : -
Note : -

DNA sequence :
ATGAAGATTTTGCCCTTCGTTGCGCTGACCGCAACCCTGTTCTCGTCCGGCGCTGCTTTCGCTACTGAGCAAACCGTGAC
GCTGAATGTCGCCAACGCCACCTGTGAACTCTGCGGCCCGATCGTAAAAGGCTCGCTCAGCAAGGTGTCCGGCGTGCTCG
ATGTTCAGATATCGGAGGCGGATGGCGCCGCGATCGCAAAGGTACGTTTCGAGGACAGCCGCACGAATGTCCCCGCACTC
ATCACGGCGACCACCAATGCCGGCTATCCCTCGCGCATCGTGCAATAG

Protein sequence :
MKILPFVALTATLFSSGAAFATEQTVTLNVANATCELCGPIVKGSLSKVSGVLDVQISEADGAAIAKVRFEDSRTNVPAL
ITATTNAGYPSRIVQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 9e-08 48
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 6e-08 48
merP AAN62179.1 periplasmic mercuric ion binding protein MerP Not tested PAGI-2(C) Protein 2e-08 46
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 1e-08 45
merP AFG30122.1 MerP Not tested PAGI-2 Protein 1e-08 45
merP AGK07023.1 MerP Not tested SGI1 Protein 1e-08 45
merP AGK07081.1 MerP Not tested SGI1 Protein 1e-08 45
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 2e-08 45
merP ABQ57373.1 MerP Not tested SGI1 Protein 1e-08 45
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 5e-09 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
OCAR_7752 YP_002290713.1 mercuric transport periplasmic protein BAC0674 Protein 8e-11 47
OCAR_7752 YP_002290713.1 mercuric transport periplasmic protein BAC0675 Protein 3e-08 46
OCAR_7752 YP_002290713.1 mercuric transport periplasmic protein BAC0678 Protein 1e-08 45
OCAR_7752 YP_002290713.1 mercuric transport periplasmic protein BAC0679 Protein 2e-08 44
OCAR_7752 YP_002290713.1 mercuric transport periplasmic protein BAC0231 Protein 2e-08 44