Name : rpmE2 (Spy49_0552c) Accession : YP_002285574.1 Strain : Streptococcus pyogenes NZ131 Genome accession: NC_011375 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L31 type B Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG0254 EC number : - Position : 549590 - 549850 bp Length : 261 bp Strand : - Note : RpmE2; there appears to be two types of ribosomal proteins L31 in bacterial genomes; some contain a CxxC motif while others do not; Bacillus subtilis has both types; the proteins in this cluster do not have the CXXC motif; RpmE is found in exponentially g DNA sequence : ATGAGAAAAGACATTCATCCAGATTATCGTCCAGTTGTTTTCCTAGATACAACTACAGGTTACCAGTTCCTTAGCGGCTC AACAAAAGCTTCTAAAGAAACTGTTGAGTTTGAAGGTGAAACTTACCCACTTATCCGTGTGGAAATTTCATCAGATTCAC ACCCATTCTACACAGGACGTCAAAAGTTCACTCAAGCAGATGGACGTGTGGACCGCTTCAACAAAAAATACGGTCTCAAA GACGCAAACGCAGCAAAATAA Protein sequence : MRKDIHPDYRPVVFLDTTTGYQFLSGSTKASKETVEFEGETYPLIRVEISSDSHPFYTGRQKFTQADGRVDRFNKKYGLK DANAAK |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
rpmE2 | NP_286687.1 | 50S ribosomal protein L31 | Not tested | TAI | Protein | 2e-13 | 44 |
rpmE2 | NP_287095.1 | 50S ribosomal protein L31 | Not tested | TAI | Protein | 2e-13 | 44 |