Gene Information

Name : Rleg2_2161 (Rleg2_2161)
Accession : YP_002281670.1
Strain : Rhizobium leguminosarum WSM2304
Genome accession: NC_011369
Putative virulence/resistance : Resistance
Product : arsenate reductase
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG1393
EC number : -
Position : 2216218 - 2216640 bp
Length : 423 bp
Strand : +
Note : TIGRFAM: arsenate reductase; PFAM: arsenate reductase and related; KEGG: ret:RHE_CH02534 arsenate reductase protein

DNA sequence : 
ATGAACGTCACCATCTACCACAACCCGGCATGCGGCACCTCGCGCAATACGCTGGCGATGATCCGCAATGCAGGCATCGA
ACCCACCGTCATCGAATACGTCAAGACCCCGCCCTCGCGGGAGGAACTGGCTCGAATGATCGCCGATGCCGGCCTCACCG
TGCGTGAAGCCATTCGCCAGAAGGATACGCCCTATGCCGAACTCGGCCTCGACAATCCCGATCTGACCGACGACCAGCTT
CTCCAAGCCATGCTCGCGCAGCCGATCCTGATCAACCGCCCCTTCGTCGTGACACCGCTCGGCACGCGCCTGTCACGGCC
ATCCGAACTGGTTCTGGAAATCCTGCCGGAGACCCACAAGGGCGCCTTTACCAAGGAAGACGGCGAGAAAGTGCTGGACG
CCGAGGGGAAACGGATCGTCTGA

Protein sequence : 
MNVTIYHNPACGTSRNTLAMIRNAGIEPTVIEYVKTPPSREELARMIADAGLTVREAIRQKDTPYAELGLDNPDLTDDQL
LQAMLAQPILINRPFVVTPLGTRLSRPSELVLEILPETHKGAFTKEDGEKVLDAEGKRIV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
arsC ADZ05768.1 arsenate reductase Not tested AbaR11 Protein 5e-46 74
arsC AFC76436.1 ArsC Not tested AbaR5 Protein 4e-46 74
arsR CAJ77019.1 arsenate reductase Not tested AbaR1 Protein 3e-46 74
arsC2 YP_001007634.1 arsenate reductase Not tested YAPI Protein 4e-43 68

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rleg2_2161 YP_002281670.1 arsenate reductase BAC0584 Protein 7e-46 68
Rleg2_2161 YP_002281670.1 arsenate reductase BAC0583 Protein 1e-44 68
Rleg2_2161 YP_002281670.1 arsenate reductase BAC0582 Protein 1e-44 66
Rleg2_2161 YP_002281670.1 arsenate reductase BAC0585 Protein 2e-43 66