Gene Information

Name : Gdia_2534 (Gdia_2534)
Accession : YP_002276893.1
Strain : Gluconacetobacter diazotrophicus PAl 5
Genome accession: NC_011365
Putative virulence/resistance : Resistance
Product : arsenate reductase
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG1393
EC number : -
Position : 2788508 - 2788873 bp
Length : 366 bp
Strand : +
Note : TIGRFAM: arsenate reductase; PFAM: arsenate reductase and related; KEGG: gdi:GDI3649 putative arsenate reductase

DNA sequence : 
ATGTGCGTAACCATCTACCATAACCCGGCCTGCGGCACGTCGCGGACCGTGCTGGGCCTGATCCGCGATGCGGGCATCGC
GCCCACCATCATCGAATATCTGAAGACGCCGCCATCGCGTGACGAACTGGCCGGGCTGATCGCGCGCATGGGGGTGCCGG
TGCGCGACGTGCTGCGCCGCCGGGGAACGCCCCATGACGAACTGGGGCTGGATGACGCGGGGCTGAGCGACGACCGGCTG
CTCGACGCCATAATGGCGCATCCGATCCTGATCAACCGGCCGATCGTCGTGACGCCGCTGGGGGTCAGGCTGTGCCGCCC
GGCCGAGCGCGTCCTGGACATCCTGCCGCCGCGCCAGGGCGCGTGA

Protein sequence : 
MCVTIYHNPACGTSRTVLGLIRDAGIAPTIIEYLKTPPSRDELAGLIARMGVPVRDVLRRRGTPHDELGLDDAGLSDDRL
LDAIMAHPILINRPIVVTPLGVRLCRPAERVLDILPPRQGA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
arsC2 YP_001007634.1 arsenate reductase Not tested YAPI Protein 3e-33 63
arsC ADZ05768.1 arsenate reductase Not tested AbaR11 Protein 6e-31 55
arsC AFC76436.1 ArsC Not tested AbaR5 Protein 3e-31 55
arsR CAJ77019.1 arsenate reductase Not tested AbaR1 Protein 2e-31 55

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Gdia_2534 YP_002276893.1 arsenate reductase BAC0583 Protein 4e-35 64
Gdia_2534 YP_002276893.1 arsenate reductase BAC0584 Protein 7e-36 64
Gdia_2534 YP_002276893.1 arsenate reductase BAC0582 Protein 1e-34 63
Gdia_2534 YP_002276893.1 arsenate reductase BAC0585 Protein 3e-35 62