Gene Information

Name : ECH74115_5080 (ECH74115_5080)
Accession : YP_002273184.1
Strain : Escherichia coli EC4115
Genome accession: NC_011353
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : R : General function prediction only
COG ID : COG2916
EC number : -
Position : 4722890 - 4723261 bp
Length : 372 bp
Strand : -
Note : identified by match to protein family HMM PF00816

DNA sequence :
ATGAATATGGAAAATAATTCACATACAACAAGTCCATACATTCAGCTTATAGAGCAAATTGCAGTTCTACAGCAGGAAGC
AAAGCGACTGCGAGAGCAGGAAGTTCAAAGTGTAATTGAGTCGATTCAGAAGCAGATTACTTATTACAATATAACCTTAC
AAGAGCTGGGATATACTAATGTGCCTGATGATGGACTCGCTCGCCGGAACTCATCGAAAGGTGTTTACTACCGCAATGAA
GAAGGGCAGACCTGGTCGGGCGTAGGCCGACAGCCACGCTGGCTTAAAGAAGCACTGTTGAATGGAATGAAGAAAGAAGA
TTTTCTTGTGAAGGACACTGAAGAAGAAATAATACCGCTGAAAAATATTTAA

Protein sequence :
MNMENNSHTTSPYIQLIEQIAVLQQEAKRLREQEVQSVIESIQKQITYYNITLQELGYTNVPDDGLARRNSSKGVYYRNE
EGQTWSGVGRQPRWLKEALLNGMKKEDFLVKDTEEEIIPLKNI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AAC31533.1 L0054 Not tested LEE Protein 2e-52 100
ler ACU09478.1 transcription regulator Ler Not tested LEE Protein 2e-52 100
Z5140 NP_290288.1 hypothetical protein Not tested LEE Protein 2e-52 100
ECs4588 NP_312615.1 hypothetical protein Virulence LEE Protein 2e-52 100
ler YP_003236108.1 transcriptional regulator Ler Not tested LEE Protein 3e-52 99
unnamed AAC38364.1 Orf1 Virulence LEE Protein 2e-52 99
ler YP_003223495.1 transcription regulator Ler Not tested LEE Protein 8e-52 97
ler AAK26696.1 Ler Virulence LEE Protein 6e-52 97
ler YP_003232133.1 transcriptional regulator Ler Not tested LEE Protein 8e-52 97
ler AAL57523.1 Ler Virulence LEE Protein 6e-52 97
ler AAL57584.1 Ler Virulence LEE Protein 6e-52 97
ler CAC81843.1 Ler protein Not tested LEE II Protein 6e-52 97
unnamed AAL06349.1 LEE-encoded regulator Virulence LEE Protein 2e-48 89
ler CAI43893.1 LEE encoded regulator Virulence LEE Protein 4e-41 86
ler AFO66395.1 locus of enterocyte effacement (LEE)-encoded regulator Virulence SESS LEE Protein 2e-36 65
ler AFO66332.1 locus of enterocyte effacement-encoded regulator Virulence SESS LEE Protein 2e-36 65

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECH74115_5080 YP_002273184.1 hypothetical protein VFG0832 Protein 7e-53 100
ECH74115_5080 YP_002273184.1 hypothetical protein VFG0710 Protein 9e-53 99