Gene Information

Name : ECH74115_5033 (ECH74115_5033)
Accession : YP_002273140.1
Strain : Escherichia coli EC4115
Genome accession: NC_011353
Putative virulence/resistance : Unknown
Product : IS911 transposase orfA
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 4685479 - 4685793 bp
Length : 315 bp
Strand : +
Note : identified by match to protein family HMM PF01527

DNA sequence :
ATGAACAAGAAAACCAAACGTACTTTCACCCCTGAATTCAGGCTGGAATGTGCACAGCTAATTGTTGATAAGGGCTACTC
ATATCGACAAGCCAGTGAAGCGATGAATGTCGGTTCTACCACGCTTGAGAGTTGGGTGCGCCAGCTCAGGCGAGAGCGTC
AGGGGATTGCGCCCTCTGCCACACCTATTACTCCAGACCAGCAACGTATCCGCGAACTGGAAAAGCAGGTTCGCCGCCTG
GAGGAACACAATACGATATTAAAAAAGGCTACAACCGCGCTCTTGATGTCCGACTCGCTGAACGGTTCACGATAG

Protein sequence :
MNKKTKRTFTPEFRLECAQLIVDKGYSYRQASEAMNVGSTTLESWVRQLRRERQGIAPSATPITPDQQRIRELEKQVRRL
EEHNTILKKATTALLMSDSLNGSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 3e-44 100
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 2e-44 100
unnamed AAC31483.1 L0004 Not tested LEE Protein 2e-44 100
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 2e-44 100
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 6e-42 98
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 4e-42 98
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-27 64
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-27 64
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-27 64
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-27 64
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-27 64
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-27 64
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-27 64
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-27 64
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 8e-23 60
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 4e-23 59
l7045 CAD33744.1 - Not tested PAI I 536 Protein 4e-23 59
api80 CAF28554.1 putative transposase Not tested YAPI Protein 2e-19 55
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 3e-21 53
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 2e-20 50
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 6e-20 50
tnpA CAB61575.1 transposase A Not tested HPI Protein 2e-19 49
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 4e-14 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECH74115_5033 YP_002273140.1 IS911 transposase orfA VFG0784 Protein 6e-45 100
ECH74115_5033 YP_002273140.1 IS911 transposase orfA VFG1123 Protein 5e-28 64
ECH74115_5033 YP_002273140.1 IS911 transposase orfA VFG1485 Protein 2e-23 59
ECH74115_5033 YP_002273140.1 IS911 transposase orfA VFG1553 Protein 1e-21 53
ECH74115_5033 YP_002273140.1 IS911 transposase orfA VFG1566 Protein 2e-14 41