Gene Information

Name : VSAL_I0439 (VSAL_I0439)
Accession : YP_002261967.1
Strain :
Genome accession: NC_011312
Putative virulence/resistance : Unknown
Product : transposase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 488216 - 488527 bp
Length : 312 bp
Strand : +
Note : -

DNA sequence :
ATGACTAAACGTATAAGACGATTATTTAGCACTGAATTTAAACTAGAAGCAGCTCAGCTGGTTCTTGACCAAAATCACTC
TGTCGCTGAAGTAGCTAAAGCAATGAATGTCGGTAAATCAACAATGGATAAATGGGTTCGACAACTAAAAAATGAACGAT
TAGGAAAATCTCCCAAAGAATCCCCCATAACTCCAGAGCAAATTGAAATTCGGGAATTGAAAAAGAAATTAGCTCGTTTA
GAAGAGCATAATTCAATACTAAAAAAGGCTACGGCTCTGTTGATGTCAGACTCCTTGAACAATTCGCATTAA

Protein sequence :
MTKRIRRLFSTEFKLEAAQLVLDQNHSVAEVAKAMNVGKSTMDKWVRQLKNERLGKSPKESPITPEQIEIRELKKKLARL
EEHNSILKKATALLMSDSLNNSH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-37 88
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-37 88
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-37 88
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-37 88
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-37 88
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-37 88
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-37 88
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-37 88
l7045 CAD33744.1 - Not tested PAI I 536 Protein 5e-29 71
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 5e-29 71
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 1e-28 71
api80 CAF28554.1 putative transposase Not tested YAPI Protein 2e-24 70
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 2e-23 62
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 3e-25 58
unnamed AAC31483.1 L0004 Not tested LEE Protein 3e-25 58
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 4e-25 58
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 4e-25 58
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 5e-26 58
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 7e-26 58
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 8e-20 51
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 7e-13 44
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 1e-15 43
tnpA CAB61575.1 transposase A Not tested HPI Protein 5e-15 42
unnamed CAD33780.1 putative transposase Not tested PAI I 536 Protein 2e-11 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
VSAL_I0439 YP_002261967.1 transposase VFG1123 Protein 7e-38 88
VSAL_I0439 YP_002261967.1 transposase VFG1485 Protein 2e-29 71
VSAL_I0439 YP_002261967.1 transposase VFG1553 Protein 7e-24 62
VSAL_I0439 YP_002261967.1 transposase VFG0784 Protein 1e-25 58
VSAL_I0439 YP_002261967.1 transposase VFG1566 Protein 3e-13 44
VSAL_I0439 YP_002261967.1 transposase VFG1521 Protein 7e-12 41