
|
Name : soxS (KPK_5208) Accession : YP_002240978.1 Strain : Klebsiella pneumoniae 342 Genome accession: NC_011283 Putative virulence/resistance : Resistance Product : DNA-binding transcriptional regulator SoxS Function : - COG functional category : K : Transcription COG ID : COG2207 EC number : - Position : 5261907 - 5262236 bp Length : 330 bp Strand : + Note : regulates genes involved in response to oxidative stress DNA sequence : ATGTCCCATCAGGATATTATTCAAACACTGATTGAATGGATTGATGAACATATCGATCAACCACTTAACATTGATATAGT CGCCAGAAAGTCAGGATACTCGAAATGGTATCTGCAGCGGATGTTCCGTACCGTAATGCATCAGACGCTGGGTGATTATA TTCGTCAGCGCCGCCTGCTGCTGGCGGCGGAAGCGTTGCGAACCACTCAGCGACCTATCTTTGATATCGCGATGGATCTG GGCTACGTCTCGCAGCAAACCTTCTCCCGGGTGTTCCGTCGCGAGTTCGACCGCACTCCCAGCGACTACCGCCATCAGAT CTCCGCGTGA Protein sequence : MSHQDIIQTLIEWIDEHIDQPLNIDIVARKSGYSKWYLQRMFRTVMHQTLGDYIRQRRLLLAAEALRTTQRPIFDIAMDL GYVSQQTFSRVFRREFDRTPSDYRHQISA |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| soxS | YP_219131.1 | DNA-binding transcriptional regulator SoxS | Not tested | SPI-4 | Protein | 2e-35 | 91 |
| tetD | AAL08447.1 | putative transcriptional regulator TetD | Not tested | SRL | Protein | 1e-14 | 47 |
| tetD | AEA34665.1 | tetracycline resistance protein D | Not tested | Not named | Protein | 1e-14 | 47 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| soxS | YP_002240978.1 | DNA-binding transcriptional regulator SoxS | CP000647.1.gene4499. | Protein | 2e-38 | 100 |
| soxS | YP_002240978.1 | DNA-binding transcriptional regulator SoxS | CP001918.1.gene327.p | Protein | 3e-37 | 93 |
| soxS | YP_002240978.1 | DNA-binding transcriptional regulator SoxS | CP001138.1.gene4488. | Protein | 6e-36 | 91 |
| soxS | YP_002240978.1 | DNA-binding transcriptional regulator SoxS | BAC0371 | Protein | 5e-35 | 89 |
| soxS | YP_002240978.1 | DNA-binding transcriptional regulator SoxS | NC_002695.1.914293.p | Protein | 5e-35 | 89 |
| soxS | YP_002240978.1 | DNA-binding transcriptional regulator SoxS | CP000034.1.gene4505. | Protein | 9e-35 | 88 |
| soxS | YP_002240978.1 | DNA-binding transcriptional regulator SoxS | CP001138.1.gene612.p | Protein | 1e-18 | 49 |
| soxS | YP_002240978.1 | DNA-binding transcriptional regulator SoxS | NC_010558.1.6276025. | Protein | 6e-15 | 47 |
| soxS | YP_002240978.1 | DNA-binding transcriptional regulator SoxS | CP000647.1.gene1624. | Protein | 1e-15 | 42 |
| soxS | YP_002240978.1 | DNA-binding transcriptional regulator SoxS | CP001918.1.gene2033. | Protein | 8e-16 | 42 |
| soxS | YP_002240978.1 | DNA-binding transcriptional regulator SoxS | CP001138.1.gene1637. | Protein | 7e-16 | 41 |
| soxS | YP_002240978.1 | DNA-binding transcriptional regulator SoxS | BAC0560 | Protein | 6e-16 | 41 |
| soxS | YP_002240978.1 | DNA-binding transcriptional regulator SoxS | NC_002695.1.917339.p | Protein | 6e-16 | 41 |
| soxS | YP_002240978.1 | DNA-binding transcriptional regulator SoxS | CP000034.1.gene1596. | Protein | 6e-16 | 41 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| soxS | YP_002240978.1 | DNA-binding transcriptional regulator SoxS | VFG0585 | Protein | 6e-36 | 91 |
| soxS | YP_002240978.1 | DNA-binding transcriptional regulator SoxS | VFG1038 | Protein | 5e-15 | 47 |