Gene Information

Name : SSPA2545 (SSPA2545)
Accession : YP_002143390.1
Strain : Salmonella enterica AKU12601
Genome accession: NC_011147
Putative virulence/resistance : Virulence
Product : pathogenicity island 1 effector protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2826157 - 2826399 bp
Length : 243 bp
Strand : -
Note : similar to Salmonella typhi CT18 pathogenicity 1 island effector protein

DNA sequence :
ATGCCAACACCTTGGTCAGGCTATCTGGATGAAGTTTCAGCAAAATTTGATACGGGCGTTGATGATCTACAAACGCAGGT
AACAGAGGCGCTGGATAAATTAGCAGCAAAACCCTCCGATCCGGCGCTACTGGCGGCGTATCAGAGTAAGCTCTCGGAAT
ATAACTTGTACCGTAACGCGCAATCGAACACGGTAAAAGTCTTTAAGGATATTGATGCTGCCATTATTCAGAACTTCCGT
TAA

Protein sequence :
MPTPWSGYLDEVSAKFDTGVDDLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSNTVKVFKDIDAAIIQNFR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
prgI NP_461794.1 needle complex major subunit Virulence SPI-1 Protein 3e-30 97
prgI AAX49613.1 PrgI Virulence SPI-1 Protein 2e-30 97
prgI NP_457267.1 pathogenicity 1 island effector protein Virulence SPI-1 Protein 5e-30 97
prgI NP_806476.1 pathogenicity island 1 effector protein Virulence SPI-1 Protein 5e-30 97
prgI YP_217792.1 cell invasion protein Virulence SPI-1 Protein 3e-30 97
ECs3718 NP_311745.1 EprI Not tested LIM Protein 5e-20 63
ysaG AAS66835.1 YsaG Not tested SSR-1 Protein 1e-16 52

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SSPA2545 YP_002143390.1 pathogenicity island 1 effector protein VFG0535 Protein 7e-31 97
SSPA2545 YP_002143390.1 pathogenicity island 1 effector protein VFG0996 Protein 4e-19 69
SSPA2545 YP_002143390.1 pathogenicity island 1 effector protein VFG2466 Protein 1e-17 57