Name : SSPA2378 (SSPA2378) Accession : YP_002143223.1 Strain : Salmonella enterica AKU12601 Genome accession: NC_011147 Putative virulence/resistance : Unknown Product : positive regulator of late gene transcription Function : - COG functional category : - COG ID : - EC number : - Position : 2658208 - 2658426 bp Length : 219 bp Strand : - Note : similar to Salmonella typhi CT18 positive regulator of late gene transcription DNA sequence : ATGATGAATTGTCCAAAGTGTGGACACTCAGCGCACACTAGGAGCAGCTTTCAGGTTACGGACAGCACAAAAGAGCGTTA CTGCCAGTGCCAGAACATTAACTGTGGTAGCACCTTTGTCACCCATGAAACGGTAGTGCGCTTTATAGTTACGCCAGCAT TGGTAAATAACGCTCCTCCACATCCAACAGTGAGTGGGCAAGGGCACATGAATTTTTAA Protein sequence : MMNCPKCGHSAHTRSSFQVTDSTKERYCQCQNINCGSTFVTHETVVRFIVTPALVNNAPPHPTVSGQGHMNF |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
STY4600 | NP_458683.1 | putative positive regulator of late gene transcription | Not tested | SPI-7 | Protein | 7e-29 | 100 |
t4294 | NP_807891.1 | positive regulator of late gene transcription | Not tested | SPI-7 | Protein | 7e-29 | 100 |