Gene Information

Name : czcR (Gbem_3615)
Accession : YP_002140403.1
Strain : Geobacter bemidjiensis Bem
Genome accession: NC_011146
Putative virulence/resistance : Virulence
Product : winged-helix heavy metal transcriptional response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4134188 - 4134862 bp
Length : 675 bp
Strand : +
Note : -

DNA sequence :
ATGCGCATCCTGATCGTCGAGGACGAACAAAAGGCCGCCAACTATCTCAAGAAGGGGCTCAGCGAAAACGGCTTCAGCGT
GGACATAGCCAACGACGGCGAGGACGGGCTGCACCTGGCCCTGACCGAGGTGTACAGCCTGATCATCCTCGACGTTATGC
TCCCGATACGCGGCGGATGGTCCATCATCAAGGAACTGCGCGCCGCGGGAAACGACGTCCCGGTCATCTTCCTGTCGGCG
CGCGACGAGGTGCACGACCGGGTGCACGGCCTGGAGCTTGGGGCCGACGACTACCTGGTGAAACCCTACGCCTTCTCCGA
GCTTCTGGCCCGCATCCGCATCATACTGCGCCGCTACCCGCTGCAGCAGTCCGAGTCCATGAAGCTGGCCGACCTGGAGC
TGGACCTGATCCGGCACAAGGCCCGGCGCGGCGGCCGCTCGCTCGACCTCACCGTCAAGGAATTCCAGCTCCTCGCCCTG
ATGCTGCACCGGCGCGGCGAGGTCTTGAGCCGCACCACCATCTCCGAGCAGATCTGGGGCATCAACTTCGACACCGACAC
CAACGTGGTGGACGTGGCGATCAGAAGGCTCAGGAAGAAGGTCGACGACCCCTTCCCGGTCAAACTCATCCAAACCATCA
GGGGAGTAGGCTATGTCCTCGACGAGACCGCCTGA

Protein sequence :
MRILIVEDEQKAANYLKKGLSENGFSVDIANDGEDGLHLALTEVYSLIILDVMLPIRGGWSIIKELRAAGNDVPVIFLSA
RDEVHDRVHGLELGADDYLVKPYAFSELLARIRIILRRYPLQQSESMKLADLELDLIRHKARRGGRSLDLTVKEFQLLAL
MLHRRGEVLSRTTISEQIWGINFDTDTNVVDVAIRRLRKKVDDPFPVKLIQTIRGVGYVLDETA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-53 54
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-52 53

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czcR YP_002140403.1 winged-helix heavy metal transcriptional response regulator BAC0125 Protein 8e-62 63
czcR YP_002140403.1 winged-helix heavy metal transcriptional response regulator BAC0197 Protein 2e-57 60
czcR YP_002140403.1 winged-helix heavy metal transcriptional response regulator BAC0638 Protein 2e-52 57
czcR YP_002140403.1 winged-helix heavy metal transcriptional response regulator BAC0308 Protein 4e-56 56
czcR YP_002140403.1 winged-helix heavy metal transcriptional response regulator BAC0083 Protein 8e-59 54
czcR YP_002140403.1 winged-helix heavy metal transcriptional response regulator BAC0111 Protein 4e-54 52
czcR YP_002140403.1 winged-helix heavy metal transcriptional response regulator BAC0347 Protein 2e-49 50
czcR YP_002140403.1 winged-helix heavy metal transcriptional response regulator NC_007793.3914065.p0 Protein 4e-33 44
czcR YP_002140403.1 winged-helix heavy metal transcriptional response regulator NC_002758.1121390.p0 Protein 4e-33 44
czcR YP_002140403.1 winged-helix heavy metal transcriptional response regulator NC_010079.5776364.p0 Protein 4e-33 44
czcR YP_002140403.1 winged-helix heavy metal transcriptional response regulator NC_002952.2859858.p0 Protein 4e-33 44
czcR YP_002140403.1 winged-helix heavy metal transcriptional response regulator NC_007622.3794948.p0 Protein 4e-33 44
czcR YP_002140403.1 winged-helix heavy metal transcriptional response regulator NC_003923.1003417.p0 Protein 4e-33 44
czcR YP_002140403.1 winged-helix heavy metal transcriptional response regulator NC_013450.8614146.p0 Protein 4e-33 44
czcR YP_002140403.1 winged-helix heavy metal transcriptional response regulator NC_002951.3238224.p0 Protein 4e-33 44
czcR YP_002140403.1 winged-helix heavy metal transcriptional response regulator AE015929.1.gene1106. Protein 3e-29 44
czcR YP_002140403.1 winged-helix heavy metal transcriptional response regulator HE999704.1.gene1528. Protein 3e-29 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czcR YP_002140403.1 winged-helix heavy metal transcriptional response regulator VFG0596 Protein 3e-53 54
czcR YP_002140403.1 winged-helix heavy metal transcriptional response regulator VFG1389 Protein 1e-33 45
czcR YP_002140403.1 winged-helix heavy metal transcriptional response regulator VFG1390 Protein 1e-38 42